KEGG   Streptomyces venezuelae: SVEN_6636Help
Entry
SVEN_6636         CDS       T02274                                 

Definition
Beta-galactosidase (EC:3.2.1.23)
Orthology
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
sve  Streptomyces venezuelae
Pathway
Galactose metabolism
Brite
KEGG Orthology (KO) [BR:sve00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    SVEN_6636
Enzymes [BR:sve01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     SVEN_6636
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7256395..7258419
Genome map
AA seq 674 aa AA seqDB search
MPSLDDVTRPPGRPPRILYGGDWNPEQWPEETWTEDVRLMRRAGVDSVTLGVFSWSRIEP
APGAREFGWLDRLMDLTHAHGIGVVLATPTSSPPPWLGRLHPETLPRDEDGRTEWWGSRQ
HFSHSSEAYRRYAAAITEDLAARYADHPALTMWHINNEYCTHDWGDEAARTFRRWLRHRY
GTLDALNTAWGTDFWSQRYGDWAEVLPPRRAHYLKNPAHVLDFRRYTSDQLLECFRAERD
IVRRHTPHLPVTTNFMPFWSGQDGWAWAAEEDVVSVDVYPDPRDPAAGAYNAMIGDLTRS
QAGGGPWMVMEQAAGAVNWRGVNHPKPYGLNRLWALQAVAHGADAVCYFQWRQSRQGAEK
FHSGMLGHTGERGRVFQETVRVGQDLARIGPRVAGGRVTADIAVLHDWNSWWAGDQDGKP
SRRIDHAEIVRAWHRALWDAHLPVSFAHPHHDLGAHRLVLAPHLHLLDDRAVTNLLGYVH
GGGTLVCGFLTGIADHDDRIRPGGMDARLRDLLGIDLLQEWWPLDVGEHVDCGTFRGTLW
SEELTPAPGAETVAAYRGGELDGLPAVLRNGRAWYVSTLPEPAALSRLLAGVAREAGARP
VLDGLPPGVEAVRRGDLLFLLHHGRDQVTVPLPGCHRDLLTGADTDGTLTLDRYGVAVLE
ERGPEPVPAAGERP
NT seq 2025 nt NT seq  +upstreamnt  +downstreamnt
atgccgagcctcgacgacgtgacccggccgcccggccgcccgccccgcatcctgtacggc
ggcgactggaaccccgagcagtggcccgaggagacctggacggaggacgtccggctgatg
cggcgcgccggggtcgactccgtcaccctcggcgtcttctcctggtcccgcatcgaaccc
gcccccggcgcacgcgagttcggctggctcgaccggctcatggacctgacgcacgcgcac
ggcatcggggtcgtcctcgccacccccacctcctcgcccccgccctggctcggccggctc
caccccgagacgctgccccgcgacgaggacggccggaccgaatggtggggctcgcgccag
cacttctcccactccagcgaggcctaccggcggtacgccgccgcgatcaccgaggacctc
gccgcccggtacgcggaccacccggcgctcaccatgtggcacatcaacaacgagtactgc
acccacgactggggcgacgaggccgcccgcaccttccgccgctggctccggcaccgctac
ggcaccctcgacgccctcaacaccgcctggggcaccgacttctggagccagcggtacggc
gactgggccgaggtcctgccaccccgccgcgcccactacctgaagaacccggcgcacgtc
ctcgacttccgccgctacacctccgaccagctcctggaatgcttccgcgccgaacgcgac
atcgtccgccggcacaccccgcacctcccggtgaccaccaacttcatgccgttctggtcg
ggacaggacggctgggcctgggcggcggaggaggacgtcgtctccgtcgacgtctatccc
gatccccgggacccggcggcgggcgcgtacaacgcgatgatcggcgacctcacccgctcg
caggccgggggcgggccctggatggtcatggaacaggcggccggcgcggtgaactggcgg
ggcgtcaaccaccccaagccgtacgggctcaaccgcctctgggccctccaggccgtcgcc
cacggcgccgacgccgtctgctacttccagtggcgccagtcccggcagggcgcggagaag
ttccactccgggatgctcggccacaccggggagcgcggccgggtcttccaggagaccgtc
cgcgtcggccaggacctcgcccgcatcggcccccgggtcgcgggcggccgggtcaccgcc
gacatcgccgtcctgcacgactggaactcctggtgggccggcgaccaggacgggaagccc
tcccgccggatcgaccacgccgagatcgtccgcgcctggcaccgcgccctctgggacgcc
cacctccccgtctccttcgcccacccccaccacgacctcggcgcccaccggctcgtcctc
gccccgcacctccacctcctcgacgaccgggcggtcaccaacctcctcgggtacgtccac
ggcggcggcaccctcgtctgcggcttcctcaccggcatcgccgaccacgacgaccggatc
cgccccggcggcatggacgccaggctccgggacctcctcggcatcgacctgctccaggag
tggtggccgctcgacgtgggcgagcacgtcgactgcggcacgttccgcggcacgctctgg
tccgaggaactgacccccgccccgggcgccgagaccgtcgccgcctaccggggcggggaa
ctcgacggcctgcccgccgtcctccgcaacggccgcgcctggtacgtctccaccctcccc
gaaccggccgccctgagccgcctcctcgcgggtgtcgcccgggaggccggagcgcgcccc
gtcctcgacggcctgcccccgggcgtcgaggccgtccggcgcggcgacctgctcttcctc
ctccaccacgggcgcgaccaggtcacggtcccgctgcccggatgccaccgcgacctgctc
accggcgccgacacggacggaacgctgacgctggaccggtacggggtggcggtccttgag
gagcgcggaccggagccggtcccggcagcgggggagcgtccatga

DBGET integrated database retrieval system