KEGG   Streptomyces venezuelae: SVEN_6712Help
Entry
SVEN_6712         CDS       T02274                                 

Definition
Cellulase (EC:3.2.1.4)
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
sve  Streptomyces venezuelae
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:sve00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(7342386..7343672)
Genome map
AA seq 428 aa AA seqDB search
MNPRSLRRRTTAALAALAACAALLATQAQAQAQAAPVADALTPATRFYVDPNSKAAKQAL
TDLRNGDFANAVNMARLASWPQAEWFTEGTPDEVRAKVRSLVREARLVNRTPVLVAYNVP
GRDCSQYSSGGAASSAAYRKWIDAFAAGIGDSKAVVVVEPDGLALLPSDCGPGVDPTGEL
TATRVADLTYAVRTLKAKARTTVYLDAGNVQWRPVGEMARRLLDAGVQHSDGFALNVSNT
HPTDHNTRYGTWISRCMWYATEGPEYARGHTDWCATQYYSPAAPNDGAPGNAVDPADPAT
WRWTDAWFDQNAGTPPNDALHHFVIDTSRNGLGAWTPEPGKYSGDPEIWCNAPGRGLGPR
PTADTGVPLVDAYLWVKIPGESDGSCTRNTGGTIDPEYGIVDPPAGAWWPAQAHTLARNA
APRLTFNH
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgaacccacgcagcctccggcgccgtacgaccgccgccctcgcggcgctcgcggcctgt
gccgccctcctcgcgacgcaggcgcaggcgcaggcgcaggccgcacccgtcgcggacgcg
ctcacccccgccacgaggttctacgtggacccgaacagcaaggccgccaagcaggcgctc
accgacctccggaacggagacttcgcgaacgccgtgaacatggccaggctcgcgagctgg
cctcaggccgagtggttcaccgagggcacacccgacgaggtccgggccaaggtgaggagc
ctcgtccgcgaggcccggctggtgaaccggacccccgtcctggtcgcctacaacgtcccg
ggccgcgactgttcgcagtactccagcggcggcgccgcgtcctccgccgcctaccggaag
tggatcgacgccttcgccgccggcatcggcgacagcaaagccgtcgtcgtggtcgagccc
gacggcctggccctcctcccgagcgactgcggaccgggggtggacccgaccggcgaactc
acggcgacccgcgtcgccgacctcacgtacgccgtcaggaccctcaaggccaaggcccgc
accacggtctacctcgacgccggcaacgtccagtggcggcccgtcggcgagatggcgcgg
cgactgctcgacgccggcgtccagcacagcgacggcttcgccctcaacgtctccaacacc
caccccaccgaccacaacacgcggtacggcacctggatctcccggtgcatgtggtacgcc
accgaggggcccgagtacgcccgcggccacaccgactggtgcgccacccagtactactcg
cccgccgcgcccaacgacggcgcccccggcaacgcggtcgaccccgccgaccccgccacc
tggcgctggaccgacgcctggttcgaccagaacgcgggcaccccgccgaacgacgccctg
caccacttcgtcatcgacaccagccgcaacggtctgggcgcctggaccccggagcccggc
aagtactccggcgacccggagatctggtgcaacgcacccggccgcggcctcggcccccgc
ccgaccgccgacaccggtgtcccgctcgtcgacgcctacctgtgggtcaagatccccggc
gagtccgacggcagctgcacgcgcaacaccggcggcacgatcgaccccgagtacggcatc
gtcgacccacccgccggcgcctggtggcccgcccaggcccacaccctggcccgcaacgcg
gcaccacgactgaccttcaaccactga

DBGET integrated database retrieval system