KEGG   Streptomyces venezuelae: SVEN_6713Help
Entry
SVEN_6713         CDS       T02274                                 

Definition
Endoglucanase 1 precursor (EC:3.2.1.4)
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
sve  Streptomyces venezuelae
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sve00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    SVEN_6713
Enzymes [BR:sve01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     SVEN_6713
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(7343778..7344743)
Genome map
AA seq 321 aa AA seqDB search
MRRRIRALVAALSALPLALVVAPSAHAADPTTMTSGFYTDPDSSAKKWVAANPGDGRAPA
ISTSLANTPMARWFGAWSGTIGTAAGAYVGAADQQDKLPILVAYNIYLRDSCGGHSGGGA
PSASAYATWIAQFAGGIAGRPAVVLLEPDSLADYGCLNQTQIRERQGMISGALAEFNRQS
PNTWVYLDAGNPGWVSAATMAQRLHEAGLRQAHGFSLNISNYYTTDQNTAYGNAVNSELA
ARYGYTKPFVVDTSRNGKGSNGEWCNAAGRRIGTPTRLGGGAEMLLWIKAPGESDGNCGV
GTGSTAGQFLPEAAYKMIYGY
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgcgccgcagaatccgcgccctcgtcgcagccctctccgcactgccgttggcgctcgtc
gtcgccccgtccgcccacgcggcggatcccaccaccatgaccagcgggttctacacggac
cccgactccagcgcgaagaagtgggtcgccgccaaccccggcgacggccgggcccccgcg
atcagcacctccctcgccaacacccccatggcccgctggttcggcgcctggagcggcacg
atcggcaccgcggcgggcgcgtacgtcggcgcggcggaccagcaggacaagctgcccatc
ctggtcgcgtacaacatctacctccgcgactcctgcggcgggcactccggcggcggggcc
ccgtcggcctccgcgtacgcgacctggatcgcgcagttcgccggcgggatcgcgggccgc
ccggccgtcgtcctcctcgaacccgactccctcgcggactacggctgcctgaaccagacc
cagatccgcgaacgccagggcatgatcagcggcgcgctcgccgagttcaaccggcagtcc
cccaacacgtgggtctacctggacgccggcaaccccggctgggtgagcgcggcgacgatg
gcccagcgcctccacgaagccggcctccgccaggcacacggcttctccctcaacatctcg
aactactacaccaccgaccagaacaccgcctacggcaacgcagtcaacagcgaactggcc
gcccgctacggctacaccaagccgttcgtcgtcgacaccagccgcaacggcaagggctcc
aacggcgagtggtgcaacgcggccggccgccgcatcggcacgcccacccggctgggcggg
ggcgccgagatgctgctgtggatcaaggccccgggcgagtccgacggcaactgcggcgtc
gggaccggttccacggccggccagttcctcccggaggccgcctacaagatgatctacggc
tactga

DBGET integrated database retrieval system