KEGG   Streptomyces venezuelae: SVEN_6723Help
Entry
SVEN_6723         CDS       T02274                                 

Definition
(GenBank) Aldose 1-epimerase
  KO
K01785  aldose 1-epimerase [EC:5.1.3.3]
Organism
sve  Streptomyces venezuelae
Pathway
sve00010  Glycolysis / Gluconeogenesis
sve00052  Galactose metabolism
sve01100  Metabolic pathways
sve01110  Biosynthesis of secondary metabolites
sve01120  Microbial metabolism in diverse environments
sve01130  Biosynthesis of antibiotics
Module
sve_M00632  Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Brite
KEGG Orthology (KO) [BR:sve00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SVEN_6723
   00052 Galactose metabolism
    SVEN_6723
Enzymes [BR:sve01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     SVEN_6723
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-ProteinID: CCA60009
UniProt: F2RHR5
Position
7353920..7354987
Genome map
AA seq 355 aa AA seqDB search
MNPAPSTFTGVPPVCRPDPHAGQRWTFGFPGGLTAEVHTRGARLHGLWVPDRNGTPADVV
LAPHDPARAADTARYFGSTVGRYANRIAHGRFSLDGKPYQLTTQENGHCLHGGTDGFDTR
LWEAESVHTREWTGVLLRLRSPDGDQGFPGNLDVTVSVLIGRDDELAFTYRAVTDAATLV
NLTNHAYFNLDGEGAGDILGHELAVHASHYTPVDDDLLPRGDHRPVAGAAFDLRRPLRIA
DALARPGADGGYDHNFVLSPQGDDTLRRAAVLHAPSTGRRMEVLTTEPGLQVYTAGQFDG
TVLGKSGTPYRAGAGIALETQHFPDSPNRPGDPSTVLRPGEEYRSRTVLRFGTGG
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atgaacccagcaccgtccaccttcaccggggtccccccggtctgccgccccgacccgcac
gccggacagcgatggaccttcggcttccccggcggactcacggcggaggtgcacacccgc
ggcgcccgcctccacggcctgtgggtgccggaccggaacggcaccccggccgacgtcgtc
ctcgctccccacgaccccgcccgggcggccgacaccgcccggtacttcggctccaccgtc
ggccgttacgccaaccgcatcgcacacggccggttctccctggacgggaagccgtatcag
ctgaccacgcaggagaacggccactgcctgcacggcggcaccgacggcttcgacacccgc
ctctgggaagccgagagcgtgcacacacgggagtggaccggggtgctcctgcgcctgcgg
agcccggacggcgaccagggatttccgggaaacctcgacgtcaccgtcagcgttctcatc
ggccgcgacgacgaactcgccttcacgtaccgggcggtcaccgacgcggccaccctggtc
aacctgaccaaccacgcgtacttcaacctcgacggcgagggcgcgggcgacatcctcggc
cacgaactcgccgtgcacgcctcccactacacgccggtcgacgacgacctccttccccgc
ggggaccaccgccccgtcgccggcgccgcgttcgacctccgccggccgctgaggatcgcc
gacgccctggcccgccccggcgcggacggcgggtacgaccacaacttcgtcctgagcccg
cagggcgacgacaccctccgccgcgccgccgtcctccacgcgccgtccaccggccgccgc
atggaggtgctgaccacggagcccggactgcaggtgtacaccgcggggcagttcgacgga
acggtcctcggcaagagcggtacgccctaccgggcgggcgccggcatcgcgctggagacc
cagcacttccccgactccccgaaccgccccggtgacccttccacggtgctgcgccccggc
gaggagtaccggtcgaggacggtcctgcggttcggcacgggcggctga

DBGET integrated database retrieval system