KEGG   Streptomyces venezuelae: SVEN_6731Help
Entry
SVEN_6731         CDS       T02274                                 

Definition
(GenBank) Endo-1,4-beta-xylanase A precursor
  KO
K01181  endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
sve  Streptomyces venezuelae
Brite
Enzymes [BR:sve01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.8  endo-1,4-beta-xylanase
     SVEN_6731
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_10 RicinB_lectin_2 Ricin_B_lectin
Motif
Other DBs
NCBI-ProteinID: CCA60017
UniProt: F2RHS3
Position
complement(7365292..7366740)
Genome map
AA seq 482 aa AA seqDB search
MRSHSLPPSTVRRKLGGLGAALLVGAVGAATVLVAPLTSHAAESTLGAAAKQSGRYFGTA
IASGRLNDSTYTTIANREFNSVTAENEMKIDATEPQQGRFDFTAGDRVYNWAVQNGKQVR
GHTLAWHSQQPAWMQNLSGSALRTAMTNHINGVMAHYKGKIGQWDVVNEAFADGSSGARR
DSNLQRSGNDWIEVAFRTARAADPAAKLCYNDYNVENWTWAKTQAMYAMVKDFKQRGVPI
DCVGFQSHFNNDSPYNSNFRTTLQSFAALGVDVAITELDIQGASGTTYANVTNDCLAVPR
CLGITVWGVRDTDSWRAEHTPLLFNGDGSKKPAYSSVLNALNSVSPNPNPTPTPSPGAGP
IKGVASGRCVDVPGAGTADGTQVQLWDCNNRTNQQWTLTAAGELRVYGDKCLDAAGTGNG
AKVQIYSCWGGDNQKWRLNSDGSIVGVQSGLCLDAAAGGTANGTLIQLYSCWNSGNQRWT
RT
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
atgcgttcacattcccttcccccgtccaccgtccgccggaaattgggcggcctcggcgcg
gcgctgctcgtcggcgccgtcggcgccgccaccgtgctcgtggcgcccctcacctcgcac
gccgccgagagcacgctcggcgccgcggcgaagcagagcggccggtacttcggcaccgcc
atcgcctcgggcaggctcaacgactcgacgtacacgacgatcgcgaaccgcgagttcaac
tcggtgaccgccgagaacgagatgaagatcgacgccaccgaaccccagcagggccgcttc
gacttcaccgccggcgaccgcgtctacaactgggcggtgcagaacggcaagcaggtacgg
ggccacaccctggcctggcactcccagcagcccgcctggatgcagaacctcagcggcagc
gcgctgcgcacggcgatgaccaaccacatcaacggcgtcatggcccactacaagggcaag
atcggccagtgggacgtcgtcaacgaggcgttcgcggacggcagttcgggagcgcgccgg
gactccaacctccagcggagcggcaacgactggatcgaggtcgccttccgcaccgcccgc
gccgccgacccggccgccaagctctgctacaacgactacaacgtcgagaactggacgtgg
gccaagacccaggccatgtacgccatggtcaaggacttcaagcagcgcggcgtgcccatc
gactgcgtcggcttccagtcgcacttcaacaacgacagcccctacaacagcaacttccgc
accaccctccagagtttcgccgccctcggcgtcgacgtggccatcaccgaactcgacatc
cagggcgcctcgggcacgacctacgccaacgtgaccaacgactgcctggccgtcccgcgc
tgcctcggcatcaccgtctggggtgtccgcgacaccgactcctggcgagccgagcacact
ccgctgctcttcaacggcgacggcagcaagaagcccgcctactcctccgtcctcaacgcc
ctcaactccgtctcccccaaccccaaccccactccgaccccctcccccggcgccgggccg
atcaagggagtcgcctcgggccgctgcgtggacgtacccggagccggcaccgccgacggc
acccaggtccagctgtgggactgcaacaaccgcaccaaccagcagtggaccctcaccgcc
gccggtgagctcagggtctacggcgacaagtgcctggacgccgccggcaccggcaacggc
gccaaggtccagatctacagctgctggggcggcgacaaccagaagtggcgcctcaactcc
gacggttccatcgtcggtgtccagtccggcctctgcctcgacgccgctgccggcggcacc
gccaacggcacgctgatccagctctactcctgctggaacagcggcaaccagcgctggacc
cgcacctga

DBGET integrated database retrieval system