KEGG   Streptomyces venezuelae: SVEN_6739Help
Entry
SVEN_6739         CDS       T02274                                 

Definition
hypothetical protein
Orthology
K01201  
glucosylceramidase [EC:3.2.1.45]
Organism
sve  Streptomyces venezuelae
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sve00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    SVEN_6739
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    SVEN_6739
Enzymes [BR:sve01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     SVEN_6739
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7375198..7376589
Genome map
AA seq 463 aa AA seqDB search
MKRLSALTAVVLLALTTHVAAADPAPPATGPAIDFRAELQPIDGFGFSMAFQRADLLHGA
RGLSPAKRREVLDLLLDKERGAGLSILRLGIGSSTDRVYDHMPTILPTDPGGPDAPPKYV
WDGWDGGQVWLAKEAKAYGVKRFFADAWSAPAFMKTNGSENDGGELRPEWRQAYANYLVK
YAKFYQREGIPITDLGFTNEPDWAATYASMRFTPQQAVDFLKVLGPTVRASGLKTGVVCC
DAAGWDRQVAYTEAIEADPEAAKAVRTVTGHRYSGPTTVPQPTDKRVWMSEWSPDGTTWN
ENWDDGSGYDGLTVAADIQNTLTVGNANAYVYWTGASLGATRGLIQLANPGDSYRVSKRY
WALAAFSRFIRPDAVRVPVTNADPALSVTAFRNTDGSRVIEILNTATTEKSAQFALRGGH
DRHPEGYVTDETRSITPAHVASARGTTLKATLAPRALTTIVLD
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
gtgaaacgtctatccgcgctgaccgccgtcgtattgttagcgctaacaactcacgtcgcc
gccgctgaccccgcgccacccgccaccggccccgccatcgacttccgggccgaactccag
cccatcgacggattcggcttctccatggccttccagcgggccgacctgctgcacggcgcg
cgcggcctcagccccgccaagcggcgcgaggtgctcgacctgctgctcgacaaggagagg
ggcgcgggcctgtcgatcctgcgcctgggcatcgggtcgtcgaccgaccgggtctacgac
cacatgccgacgatcctgccgaccgatcccggcgggccggacgccccgccgaagtacgtc
tgggacggctgggacggcggccaggtctggctcgccaaggaggccaaggcgtacggcgtc
aagcggttcttcgccgacgcctggagcgcgccggccttcatgaagaccaacggcagcgag
aacgacggcggcgagctccggcccgaatggcgccaggcctacgcgaactacctcgtcaag
tacgcgaagttctaccaacgggaaggcatcccgatcaccgacctggggttcaccaacgaa
cccgactgggcggcgacctacgcctcgatgcgtttcaccccgcagcaggccgtcgacttc
ctcaaggtgctcgggccgaccgtccgcgcgtccggactgaagaccggcgtcgtctgctgc
gacgcggcgggctgggaccggcaggtcgcctacaccgaggccatcgaggcggaccccgag
gccgccaaggccgtgcggaccgtcaccggccaccgctacagcggtccgaccacggtcccg
cagcccaccgacaagcgggtctggatgtcggagtggtcaccggacggcaccacctggaac
gagaactgggacgacggcagcggctacgacggcctcaccgtcgccgccgacatccagaac
accctcaccgtcggcaacgccaacgcctacgtctactggaccggcgcgtccctcggcgcc
acccggggactcatccagctcgccaaccccggcgactcctaccgggtgtccaagcggtac
tgggcgctggccgccttcagccgcttcatccgccccgacgccgtccgcgtaccggtcacg
aacgccgacccggccctgagcgtcacggccttccgcaacaccgacggcagccgcgtgatc
gagatcctcaacacggcgaccaccgagaagtccgcccagttcgccctccgcggcggccac
gaccggcaccccgagggctacgtcaccgacgagacccgctcgatcaccccggcccacgtc
gcctccgcgcgcggtacgaccctcaaggccacgctcgccccgcgcgcgctgaccacgatc
gtcctcgactga

DBGET integrated database retrieval system