KEGG   Streptomyces venezuelae: SVEN_6739Help
Entry
SVEN_6739         CDS       T02274                                 

Definition
(GenBank) hypothetical protein
Organism
sve  Streptomyces venezuelae
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
7375198..7376589
Genome map
AA seq 463 aa AA seqDB search
MKRLSALTAVVLLALTTHVAAADPAPPATGPAIDFRAELQPIDGFGFSMAFQRADLLHGA
RGLSPAKRREVLDLLLDKERGAGLSILRLGIGSSTDRVYDHMPTILPTDPGGPDAPPKYV
WDGWDGGQVWLAKEAKAYGVKRFFADAWSAPAFMKTNGSENDGGELRPEWRQAYANYLVK
YAKFYQREGIPITDLGFTNEPDWAATYASMRFTPQQAVDFLKVLGPTVRASGLKTGVVCC
DAAGWDRQVAYTEAIEADPEAAKAVRTVTGHRYSGPTTVPQPTDKRVWMSEWSPDGTTWN
ENWDDGSGYDGLTVAADIQNTLTVGNANAYVYWTGASLGATRGLIQLANPGDSYRVSKRY
WALAAFSRFIRPDAVRVPVTNADPALSVTAFRNTDGSRVIEILNTATTEKSAQFALRGGH
DRHPEGYVTDETRSITPAHVASARGTTLKATLAPRALTTIVLD
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
gtgaaacgtctatccgcgctgaccgccgtcgtattgttagcgctaacaactcacgtcgcc
gccgctgaccccgcgccacccgccaccggccccgccatcgacttccgggccgaactccag
cccatcgacggattcggcttctccatggccttccagcgggccgacctgctgcacggcgcg
cgcggcctcagccccgccaagcggcgcgaggtgctcgacctgctgctcgacaaggagagg
ggcgcgggcctgtcgatcctgcgcctgggcatcgggtcgtcgaccgaccgggtctacgac
cacatgccgacgatcctgccgaccgatcccggcgggccggacgccccgccgaagtacgtc
tgggacggctgggacggcggccaggtctggctcgccaaggaggccaaggcgtacggcgtc
aagcggttcttcgccgacgcctggagcgcgccggccttcatgaagaccaacggcagcgag
aacgacggcggcgagctccggcccgaatggcgccaggcctacgcgaactacctcgtcaag
tacgcgaagttctaccaacgggaaggcatcccgatcaccgacctggggttcaccaacgaa
cccgactgggcggcgacctacgcctcgatgcgtttcaccccgcagcaggccgtcgacttc
ctcaaggtgctcgggccgaccgtccgcgcgtccggactgaagaccggcgtcgtctgctgc
gacgcggcgggctgggaccggcaggtcgcctacaccgaggccatcgaggcggaccccgag
gccgccaaggccgtgcggaccgtcaccggccaccgctacagcggtccgaccacggtcccg
cagcccaccgacaagcgggtctggatgtcggagtggtcaccggacggcaccacctggaac
gagaactgggacgacggcagcggctacgacggcctcaccgtcgccgccgacatccagaac
accctcaccgtcggcaacgccaacgcctacgtctactggaccggcgcgtccctcggcgcc
acccggggactcatccagctcgccaaccccggcgactcctaccgggtgtccaagcggtac
tgggcgctggccgccttcagccgcttcatccgccccgacgccgtccgcgtaccggtcacg
aacgccgacccggccctgagcgtcacggccttccgcaacaccgacggcagccgcgtgatc
gagatcctcaacacggcgaccaccgagaagtccgcccagttcgccctccgcggcggccac
gaccggcaccccgagggctacgtcaccgacgagacccgctcgatcaccccggcccacgtc
gcctccgcgcgcggtacgaccctcaaggccacgctcgccccgcgcgcgctgaccacgatc
gtcctcgactga

DBGET integrated database retrieval system