KEGG   Streptomyces venezuelae: SVEN_6746Help
Entry
SVEN_6746         CDS       T02274                                 

Definition
Endo-1,4-beta-xylanase A precursor (EC:3.2.1.8)
Orthology
K01181  
endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
sve  Streptomyces venezuelae
Brite
Enzymes [BR:sve01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.8  endo-1,4-beta-xylanase
     SVEN_6746
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7383799..7386168
Genome map
AA seq 789 aa AA seqDB search
MKGLHRLRRRRRTWVAGLSAAAVVAGALTLLPGSAGAAGLGTHAAPSGRYFGTAVAAGRL
GDSAYTAIADREFNMITPENEMKWDAVEPSRGRFDFGPADRIVERALARGQRVRGHTTVW
HSQLPSWVGSIRDTKTLRGVMNHHITTQMTHYKGKIYAWDVVNEAFADGGSGRLRDSVFQ
KVLGDGFIEEAFRTARAADPSAKLCYNDYNIENWSDAKTQGVYRLVKDFTSRGVPIDCVG
FQSHFGAGGPPASFKTTLANFAALGVDVQITELDIAQASPAHYASAVSTCLSVARCTGIT
VWGVRDSDSWRSAESPLLFDRNGKPKPAYAAVMNALGSGSGPTPSKPADGTGSGTGEIKG
VASGRCLDVPASTTANGTRAQLWDCSGQANQRWTHTAGKQLKIHGDKCLDAKGKGTANGT
AVVVWDCNGGTNQQWNVHTDGTITGVQSGLCLDAVGAATANGTPIQLHACGGVGNQKWSA
PSGSGGGTCVLPSTYKWSSTGALAQPKAGWASLKDFTHVVLGGKHLVYGSNFNGSTYGSM
TFSPFTTWSDMASAGQKAMKQPAVAPTLFYFAPKKIWVLAYQWGRTAFSYRTSTDPTNPN
GWSAEQELFSGSITGSGTGPIDQTLIGDGTNMYLFFAGDNGKIYRASMPIGNFPGSFGSS
YTTVMSDTAKNLFEAPQVYKVKDQNQYLMIVEARGAGERRYFRSFTASSLSGAWTPQAAT
ESNPFAGKANSGATWTDDISHGDLIRTNPDQTMTIDPCNLQLLYQGKSPQAGGPYDQLPY
RPGVLTLQR
NT seq 2370 nt NT seq  +upstreamnt  +downstreamnt
atgaagggcctgcaccggctccgccgccgtcgccggacctgggtggcaggactgtcggcc
gcggcggtggtcgccggcgccctgacgctcctccccggctccgccggcgccgcgggcctg
ggtacgcacgcggccccctcgggccggtacttcggcacggccgtggccgcgggccgcctc
ggcgactcggcgtacaccgcgatcgccgaccgggagttcaacatgatcaccccggagaac
gagatgaagtgggacgccgtcgagccgtcccgcggccgtttcgacttcggtcccgcggac
cggatcgtcgagcgtgccctggcacgcggccagcgcgtccgcggccacaccacggtctgg
cactcgcagctcccctcctgggtgggctccatccgcgacacgaagacgctgcgcggcgtg
atgaaccaccacatcaccacccagatgacccactacaagggcaagatctacgcctgggac
gtggtcaacgaggccttcgccgatggcggcagcggccggctccgcgactcggtcttccag
aaggtgctgggcgacggcttcatcgaggaggcgttccgcaccgcccgcgcggccgacccc
tcggccaagctctgctacaacgactacaacatcgagaactggtcggacgccaagacccag
ggcgtctaccgcctggtgaaggacttcacgtcccgaggcgttcccatcgactgcgtcggc
ttccagagccacttcggcgcgggcggcccgccggcgagcttcaagacgaccctggccaac
ttcgccgccctgggcgtcgacgtccagatcaccgagctggacatcgcccaggcatcacct
gcccactacgcgagtgcggtcagcacctgtctgtccgtggcccggtgcaccggcatcacg
gtgtggggcgtccgtgacagcgactcctggcggagcgccgaaagcccgctgctgttcgac
cggaacggcaagcccaagcccgcgtacgccgccgtcatgaacgccctcggctccggctcg
ggtcccaccccgagcaagccggccgacggtacggggagcggtacgggggagatcaagggc
gtggcctccggccgctgtctggacgtccccgcctccaccaccgccaacggcacccgggcg
cagctgtgggactgtagcggccaggccaaccagcgctggacccacaccgccggcaagcag
ctgaagatccacggcgacaagtgcctggacgccaagggcaagggcaccgccaacggcacc
gcggtggtcgtctgggactgcaacggcggcaccaaccagcagtggaacgtccacaccgac
ggcacgatcaccggcgtccagtccggtctgtgcctcgatgccgtcggcgcggccaccgcc
aacggcaccccgatccagctgcacgcctgtgggggtgtcggcaaccagaagtggtccgcc
ccgtccggatcgggcggcggcacgtgcgtgcttccgtcgacgtacaagtggagctcgacg
ggtgccctggcgcagcccaaggccgggtgggcctcgctgaaggacttcacccatgtggtg
ctgggcggcaagcacctggtctacgggtcgaacttcaacggatcgacgtacggctcgatg
acgttcagccccttcaccacctggtcggacatggcgtccgcaggacagaaggcgatgaag
cagcccgcggtcgcacccaccctgttctacttcgcacccaagaagatctgggtgctggcg
taccagtggggcaggaccgcgttctcctaccggacgtcgaccgaccccaccaacccgaac
ggctggtcggcggagcaggagctcttctccggaagcatcaccggctcgggcacgggcccc
atcgaccagacgctcatcggcgacgggacgaacatgtacctgttcttcgccggtgacaac
ggcaagatctaccgggccagcatgccgatcgggaacttcccgggcagcttcggctcctcg
tacacgacggtcatgagcgacaccgcgaagaacctgttcgaggcgccgcaggtgtacaag
gtcaaggaccagaaccagtacctcatgatcgtcgaggcccggggcgcgggcgagcgccgc
tacttccgctcgttcacggcctccagcctgagcggtgcgtggaccccgcaggccgcgacc
gagagcaaccccttcgcgggcaaggccaacagcggcgccacctggaccgacgacatcagc
cacggtgatctgatccgcaccaaccccgatcagaccatgaccatcgacccctgcaacctt
cagctgctctaccagggcaagtccccgcaggcgggcggaccctacgaccagctgccgtac
cggccgggcgtcctcaccctgcagcgctga

DBGET integrated database retrieval system