KEGG   Streptomyces venezuelae: SVEN_6814Help
Entry
SVEN_6814         CDS       T02274                                 

Definition
Formamidopyrimidine-DNA glycosylase (EC:3.2.2.23)
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
sve  Streptomyces venezuelae
Pathway
Base excision repair
Brite
KEGG Orthology (KO) [BR:sve00001]
 Genetic Information Processing
  Replication and repair
   03410 Base excision repair
    SVEN_6814
Enzymes [BR:sve01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.23  DNA-formamidopyrimidine glycosylase
     SVEN_6814
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.99  Other carbon-oxygen lyases
    4.2.99.18  DNA-(apurinic or apyrimidinic site) lyase
     SVEN_6814
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7463468..7464340
Genome map
AA seq 290 aa AA seqDB search
MPELPEVEALRAFLDTHLVGKEIARVLPVAISVLKTYDPPLSAVEGAEVTAIARHGKFLD
LTTTGPGGELHLLFHLARAGWLRWQDPLPSGPPKPGKGPLALRTALTGGDGFDLTEAGTT
KRLAVYVVRDPREVPGVARLGPDPLAEDFGPAEFAALLAGERRQIKGALRDQSLIAGIGN
AYSDEILHAAKMSPFKPTQNLTPTETAALYAAMRTTLHEAVERSHGLAAGRLKAEKKSGL
RVHGRTGEPCPVCGDTIREVSFSDSSLQYCPTCQTGGKPLADRRLSKLLK
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atgcccgaactccccgaggtggaagcgctccgcgcgttcctcgacacgcacctggtgggc
aaggagatcgcccgcgtgctgcccgtcgcgatcagcgtcctcaagacgtacgacccgccc
ctgagcgccgtcgagggcgccgaggtcaccgcgatcgcccggcacgggaagttcctcgac
ctcaccaccaccggcccgggcggcgagctccacctcctcttccacctggcccgcgcgggc
tggctccgctggcaggacccgctgccctcgggcccgcccaagcccggcaagggcccgctg
gccctgcggaccgcgctcaccggcggcgacggcttcgacctcaccgaggcgggcacgacc
aaacgcctcgccgtgtacgtggtgcgcgacccgcgggaggtaccgggcgtcgcacgcctg
ggacccgacccgctcgccgaggacttcggcccggcggagttcgccgccctgctcgccggc
gaacggcgccagatcaagggcgccctgcgcgaccagagcctcatcgcgggcatcggcaac
gcgtacagcgacgagatcctgcacgccgcgaagatgtccccgttcaaacccacccagaac
ctcaccccgacggagacggccgccctctacgcggcgatgcggaccaccctccacgaggcc
gtcgaacgctcccacggcctggccgcgggcagactcaaggccgagaagaagagcggcctg
cgggtccacggccgcaccggcgaaccctgccccgtgtgcggggacaccatccgcgaggtc
tccttcagcgactcctccctccagtactgcccgacctgccagaccggcggcaagcccctc
gccgaccgccgcctgtcgaaactcctcaagtag

DBGET integrated database retrieval system