KEGG   Streptomyces venezuelae: SVEN_7181Help
Entry
SVEN_7181         CDS       T02274                                 

Definition
(GenBank) dTDP-4-dehydrorhamnose 3,5-epimerase
  KO
K01790  dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
sve  Streptomyces venezuelae
Pathway
sve00521  Streptomycin biosynthesis
sve00523  Polyketide sugar unit biosynthesis
sve01130  Biosynthesis of antibiotics
Module
sve_M00793  dTDP-L-rhamnose biosynthesis
Brite
KEGG Orthology (KO) [BR:sve00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    SVEN_7181
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    SVEN_7181
Enzymes [BR:sve01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     SVEN_7181
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: dTDP_sugar_isom
Motif
Other DBs
NCBI-ProteinID: CCA60467
UniProt: F2RLT7
Position
complement(7889795..7890346)
Genome map
AA seq 183 aa AA seqDB search
MKATEVPEISGAFLFEPTPYADERGFFCRTFDADVVRSVGLDPGAFVQDSVSRSVRGVLR
GLHLRSGAGEAKLVRCSYGRIFDVVVDLRADSPTYRNVATFELSGETQRTLYVPAGCAHG
FQALTDTADTSYRIDRPHDPAEDVTIAFDDPELAIPWPLPATSMSPRDREAPRLAEALKQ
AEK
NT seq 552 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcgaccgaagtcccggagatctccggggccttcctgttcgaaccgacgccgtac
gccgacgaacgcggcttcttctgccgcaccttcgacgccgacgtggtccgctcggtgggc
ctcgacccgggcgccttcgtccaggacagcgtgtcccgctcggtccgcggtgtgctgcgc
ggcctccatctgcgctcgggcgccggcgaggccaagctcgtccgctgctcgtacgggagg
atcttcgacgtggtcgtcgacctgcgggcggactcgccgacctaccgcaacgtggccacc
ttcgagctgtccggcgagacgcagcggaccctgtacgtcccggcggggtgcgcgcacggc
ttccaggcgctgaccgacaccgccgacacctcgtaccggatcgaccgcccgcacgatccc
gccgaggacgtgacgatcgccttcgacgacccggagctcgccattccgtggccgctgccg
gcgacctcgatgtccccacgggaccgggaggcgccgcgcctcgccgaggccctgaagcaa
gcggagaagtga

DBGET integrated database retrieval system