KEGG   Streptomyces venezuelae: SVEN_7349Help
Entry
SVEN_7349         CDS       T02274                                 

Definition
secreted hydrolase
Orthology
K01201  
glucosylceramidase [EC:3.2.1.45]
Organism
sve  Streptomyces venezuelae
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:sve00600]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:sve00511]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(8080712..8082676)
Genome map
AA seq 654 aa AA seqDB search
MHNTLVRGLTLLRRGGGRRRPGDGAPPVRARRIRPLTALTAGALVASSLVLTGPGTAQAA
GERVDVWLTTTSDSGGRTVTRGLAQQAPLAFGPAGGTANHTITVDENTTYQQFEGGGASI
TDTTAHLLRGGAVSAATRDDVMRKLFSPTEGIGLSFVRNPIGASDLSRPGNVSLDDTCCD
LNDFGANGYDTDVRLLTAQAKQLNPALRVKGVPWSAPGWMKDNGRMDQMGWLKAEYYPLY
AQYLVKYVQSYQAAGVKVDYLSVQNEPNCCQAGNPTAMNYPGMSWNPAGLVEFTKNHVYP
AFRAAGLTTKVLVHDWNYGDYANFGAGVLGDAGVRNDPLFGGIAWHGYFGDPAVGTQVHD
QYPSVKQFSTEHSGGTWIGNQHNEDLSDIVNYARNWSGSLVKWSLGLNQNMGPHNGGCGT
CTGLITVQEGGARAGQVDYTIEYYTTGHLTKFVKPGAYRIASTANGTVQNVAWRNADGGK
ALIAHNGGTSAQSVRVDWGNQSFTYTLPARTTATFTWSGTTGGGPGAGTLTGLAGKCLDV
AGGATADGTPVQLYGCNGTPAQRWTLAADGSVRALGKCLDVTGGSTADGARVQLYNCNGT
AAQRWTYSATTHDVVNAGANKCLDITGNSSADGTRAQIWTCTGGANQKWTHNAA
NT seq 1965 nt NT seq  +upstreamnt  +downstreamnt
gtgcataacacacttgtgcgtgggctcacgctcctcaggcgaggagggggacgacggcgc
ccgggggacggcgcccctcccgtccgcgcccgccgcatccggccgttgaccgcgctcacc
gccggcgccctggtcgcgagcagcctggtcctgaccggccccggaaccgcgcaggcggcc
ggcgagcgggtcgacgtctggctgaccaccacctcggactccggcggccgtaccgtcacc
cgcggtctggcgcagcaggcccccctcgccttcggcccggcaggcggcaccgcgaaccac
acgatcaccgtcgacgagaacaccacgtaccagcagttcgagggcggcggcgcgtcgatc
accgacaccaccgcccatctgctgcggggcggcgccgtcagcgccgccacccgggacgac
gtgatgcgcaagctgttctcgccgaccgagggcatcggcctgtccttcgtccgcaacccc
atcggcgcctcggacctctcccgccccgggaacgtctcgctcgacgacacctgctgcgac
ctgaacgacttcggcgcgaacggctacgacaccgacgtccggctgctgaccgcgcaggcc
aagcagctcaacccggccctgcgggtcaagggcgtgccgtggagcgcgccgggctggatg
aaggacaacggccggatggaccagatgggctggctgaaggcggagtactacccgctgtac
gcccagtacctggtcaagtacgtgcagagctaccaggccgcgggggtcaaggtcgactac
ctctccgtgcagaacgagccgaactgctgccaggccggcaacccgaccgccatgaactac
ccgggcatgagctggaaccccgccggactcgtcgagttcaccaagaaccacgtctacccg
gcgttccgcgcggcgggcctcaccaccaaggtcctggtgcacgactggaactacggcgac
tacgcaaacttcggcgccggtgtcctgggcgacgcgggcgtccgcaacgacccgctgttc
ggcggcatcgcctggcacggctacttcggcgacccggccgtcggcacccaggtccacgac
cagtacccctcggtgaagcagttcagcaccgagcactcgggcggcacctggatcggcaac
cagcacaacgaggacctctccgacatcgtgaactacgcccgcaactggagcggcagcctg
gtcaagtggagcctcgggctcaaccagaacatgggcccgcacaacggcggctgcggcacc
tgcaccggtctcatcaccgtgcaggagggcggcgctcgggccgggcaggtcgactacacg
atcgagtactacacgacgggtcacctcacgaagttcgtgaagcccggcgcgtaccgcatc
gcctccaccgccaacggcaccgtgcagaacgtggcctggcgcaacgccgacggcggcaag
gcgctcatcgcccacaacggcggcacgtcggcgcagtccgtccgggtcgactggggcaac
cagtccttcacgtacaccctgcccgcccggaccaccgcgaccttcacctggtcggggacg
accggcggcgggcccggcgcggggacgctgaccggcctggccgggaagtgcctggacgtg
gccggcggcgccaccgccgacggcacccccgtccagctgtacgggtgcaacggcaccccc
gcgcagcgctggacgctcgcagcggacggcagcgtgcgggcgctcgggaagtgcctcgac
gtcaccggcggttcgacggccgacggcgcccgggtccagttgtacaactgcaacggcacc
gccgcgcagcgctggacgtacagcgccacgacgcacgacgtggtcaacgccggcgcgaac
aagtgcctggacatcaccggcaactcctccgccgacgggacacgggcgcagatctggacc
tgcaccggcggggccaaccagaagtggacccacaacgcggcctga

DBGET integrated database retrieval system