KEGG   Saccharomonospora viridis: Svir_01720Help
Entry
Svir_01720        CDS       T00980                                 

Definition
beta-glucosidase-like glycosyl hydrolase
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
svi  Saccharomonospora viridis
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:svi00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Svir_01720
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    Svir_01720
Enzymes [BR:svi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Svir_01720
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
180323..181474
Genome map
AA seq 383 aa AA seqDB search
MKRLMLAAACVALLGTAACGDGGDQAGDGNTASPPPDQQDTQQTSATQQPGGECAGVIEG
LSPRERAAQLLVVGVDPTDPAAAVALVREHRVGGIFIGGNPTALFTDNALDRVQEAAGDI
PVSVAVDDEGGRVQRIDELVGPIPSARQMAQSMTPQEVRELARERGEQLSARGVTVDYAP
VVDLTDGPANGVIGDRSFSADPQTATEYAAAFASGLSEAGVQPVIKHFPGHGRASGDSHQ
ELVQTPPLDELRTHDLVPYEDLSVYPDDTQVMVGHLDVPGLTDGQPASLSPAAYRLLRDE
YDYDGVVLTDDLGAMRAVTDNYTLDEAVLLALQSGADQPLWSSGGDVGPVLDKLEAAMAD
GQLSQERVDEALTRVLTAKGVCG
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atgaagcgattgatgcttgcggccgcgtgtgtcgctttgttgggaacggcagcctgtggt
gacggtggggaccaggcgggtgacggtaatacggcctcgccgcccccggaccagcaggac
acgcaacagacgagcgccacacagcagcccggtggtgagtgcgcaggtgtgatcgagggg
ctttcccccagggagcgtgctgctcagctgctcgtggtcggtgtggacccgaccgacccg
gccgcggccgtcgcgctggtacgcgaacaccgggtcggcggcatcttcatcggcggtaac
cccaccgccctgttcaccgacaacgcgctggaccgggtgcaggaagccgcgggcgacatc
cccgtgtccgtcgccgtcgacgacgagggcgggcgggtgcagcgcatcgacgaactcgtc
ggacccatccccagtgcccgacagatggcgcagtcgatgacaccgcaggaagtgcgggag
ctggcgcgcgaacgcggtgagcaactgagcgcccgtggcgtcaccgtcgattacgcgccc
gtggtcgacctgaccgacggccccgcgaacggtgtcatcggtgaccggtcgttcagcgcc
gacccgcagacggccacggagtacgcggcggcgttcgcttccgggctgtcggaggcgggt
gtgcagcccgtcatcaagcatttccccgggcacggccgagccagtggtgactcccaccag
gagctggtgcagacgccaccgctggacgaactgcgcacccacgacctggtgccctatgag
gacctcagcgtctatcccgacgacacgcaggtgatggtgggccatctcgacgtccccggc
ctcaccgacggacagcccgcctccctgtcgcccgcggcgtaccggttgctgcgggacgag
tacgactacgacggtgtcgtgctcaccgacgacctcggtgcgatgagggcggtcaccgac
aactacaccctcgacgaggccgtgctgttggcgttgcagtccggcgccgatcaaccgctg
tggtcgtccggcggggacgtcggtcccgtgctcgacaagctggaagccgccatggccgat
ggtcagctgtcgcaggagcgggtcgacgaagcgctcaccagggtgctgacggcgaagggc
gtctgcggttag

DBGET integrated database retrieval system