KEGG   Saccharomonospora viridis: Svir_02880Help
Entry
Svir_02880        CDS       T00980                                 

Definition
delta-aminolevulinic acid dehydratase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
svi  Saccharomonospora viridis
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Heme biosynthesis, glutamate => protoheme/siroheme
Brite
KEGG Orthology (KO) [BR:svi00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Svir_02880
Enzymes [BR:svi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     Svir_02880
Exosome [BR:svi04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Svir_02880
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
287705..288676
Genome map
AA seq 323 aa AA seqDB search
MFPEHRPRRLRTTAAMRRLVSETTLRPRQLILPLFVAEDAREPRPIGSMPGVVQHTRDTL
RRAAVEAVEAGVGGLMLFGVPAERDAVGGGATDADGILNVALRDLRSELGDATVLMADTC
LDEFTDHGHCGVLDESGAVDNDATLERYAEMALAQAEAGAHMLGPSGMMDGQVGVIRRAL
DDAGYTDTGILAYSAKYASAFYGPFREAVDSQLTGDRNTYQQDPGNAREALREIELDIAE
GADAVMVKPALAYLDVVKAAAEVSPVPVAAYNISGEYSMIEGAAANGWIDRERTILEVLT
SIRRAGADLILTYWAAEAAAWLD
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
gtgtttccggaacatcgtcctcgtcggctgcgcaccaccgccgccatgcgccggctggtg
agtgagaccacgctgcgccctcgtcagttgatcctgcccctgttcgtcgccgaggacgcg
cgggagccgcgtcccatcgggagcatgcccggtgtcgtgcaacacacccgggacacgttg
cgccgggccgccgtcgaggcggtcgaggccggggtcggtgggttgatgctgttcggcgtt
cccgccgagcgggacgccgtcggtggcggggccaccgatgccgacgggatcctcaacgtc
gccctacgcgatctgcggtccgagctcggcgacgccaccgtgttgatggccgacacgtgt
ctcgacgagttcaccgaccacggccactgcggtgtgctcgacgagtccggggcggtggac
aacgacgccacgttggagcgttacgccgagatggcgctcgcccaggccgaggccggggcg
cacatgctcggtccgagcgggatgatggacggtcaggtcggtgtgatccgccgggccctc
gacgacgccggttacaccgacaccggcatcctcgcgtactcggcgaagtacgccagcgcc
ttctacgggcccttccgtgaggccgtcgactcgcagctcaccggtgatcggaacacctac
cagcaggatcccggcaacgccagggaggcgctgcgggagatcgagctggacatcgccgag
ggcgccgacgccgtgatggtgaagcccgcattggcgtacctcgacgtcgtcaaggcggcg
gcggaggtgtcaccggtaccggtggcggcctacaacatctccggcgagtactcgatgatc
gaaggtgccgccgccaacggctggatcgaccgtgaacgcacgatcctggaggtgctcacc
tcgatccgcagggccggtgccgacctgatcctgacgtattgggccgctgaagcggcggct
tggctggattaa

DBGET integrated database retrieval system