KEGG   Saccharomonospora viridis: Svir_04760Help
Entry
Svir_04760        CDS       T00980                                 

Definition
(GenBank) choline dehydrogenase-like flavoprotein
  KO
K03333  cholesterol oxidase [EC:1.1.3.6]
Organism
svi  Saccharomonospora viridis
Pathway
svi00984  Steroid degradation
svi01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:svi00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00984 Steroid degradation
    Svir_04760
Enzymes [BR:svi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.3  With oxygen as acceptor
    1.1.3.6  cholesterol oxidase
     Svir_04760
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GMC_oxred_N GMC_oxred_C DAO Pyr_redox_2 FAD_binding_2 NAD_binding_8 Pyr_redox FAD_binding_3 FAD_oxidored GIDA HI0933_like Fer4_9 Thi4 Fer4_7 Fer4_8 Fer4 Fer4_3
Motif
Other DBs
NCBI-ProteinID: ACU95551
UniProt: C7MU23
Position
467652..469340
Genome map
AA seq 562 aa AA seqDB search
MDYDVVVVGSGFGGSVAALRLTEKGYRVAVIEAGRRFADDEFAKTSWDLRRYLWAPRLGC
FGIQRVHLLKDVMVLAGAGVGGGSLVYANTLYRPLKPFYTDRQWAHITDWEAELAPYYDQ
ASRMLGVVTNPTVTPSDEVMRKVAADMGVEDTYHPTPVGVYFGEPGRTVSDPYFGGIGPE
RTGCTECGACMTGCRVGAKNTLVKNYLYLAERNGAKVIPLTTVTAVRPRGDGTFEVDIRK
TGTSSRRFRHTLTAGHVVLAAGTWGTQRLLHDMRDKGVLPRLSARLGELTRTNSEAIVGA
GRPTVDPENDYSRGVAITSSIHPDENTHIEPVRYGKGSNAMSLLQTIATDGSSPVPRWKQ
ALRFVCKHPIQTLRLLNGYRWSERTVILLVMQSLDNSITTYTKRGWFGRRKYTSKQGHGK
PNPTFIPAGHKANQLTAKHIDGVAGGTWGEIFNIPLTAHFIGGAPIGTDPDNGVIDPYHR
VFNYPNLHVVDGAAITANLGVNPSLTIAAQAERAFSFWPNKGEADPRPDQREGYKRIAPV
APKNPVVPADAPGALRLPITPK
NT seq 1689 nt NT seq  +upstreamnt  +downstreamnt
gtggactacgacgtcgtagtcgtcggttcgggcttcggcggtagcgtcgccgctctgcga
ttgacggagaagggctaccgcgtcgcggtcatcgaggccggtcgccggttcgcggacgac
gagttcgccaaaacctcctgggatctacgccgttacctgtgggcaccccgcctcggctgt
ttcggcatccagcgcgttcacctgctcaaggacgtcatggtgttggcgggggcgggtgtc
ggcgggggttcgctcgtctacgccaacacgctgtaccgaccgctgaagccgttctacacg
gaccggcagtgggcgcacatcaccgactgggaggccgagctggccccgtactacgaccag
gcatcccgcatgctcggtgtggtcaccaaccccacggtgacaccgtcggacgaggtgatg
cgcaaggtcgccgccgacatgggggtcgaggacacctaccacccgacaccggtcggcgtg
tacttcggtgagcccggtcgcacggtgtcggacccgtacttcggcggtatcggaccggag
cggacaggatgcaccgaatgcggcgcctgtatgaccggatgccgcgtcggcgccaagaac
acgttggtgaagaactacctgtatctcgcggaacgcaacggcgccaaggtcatcccgttg
accacggtgacggccgtgcgccctcgcggcgacggcacgttcgaagtggacatccgcaag
accggcacgtcctcgcgccggttccggcacacgctcaccgccggccacgtggtgctggcc
gcgggcacgtggggcacgcagcggctgctgcacgacatgcgcgacaagggtgtgctgccc
cggctgtccgcacgactcggtgaactgacgcgcacgaactccgaggccatcgtcggtgcg
gggcggcccaccgtcgacccggagaacgactacagccgcggggtggccatcacgtcgtcg
atccaccccgacgagaacacccacatcgaacccgtgcgctacggcaagggcagcaacgcg
atgagtctgttgcagaccatcgccaccgacggctcgtcgccggtgccgcgttggaaacag
gcgttgcggttcgtgtgcaaacacccgatccagacgctcaggctgttgaacggttaccgg
tggagtgaacgcacggtgatcctgctggtgatgcagagtctggacaactccatcaccacc
tacaccaagcgaggctggttcggacgtcgcaagtacacgtcgaaacaggggcacggaaag
cccaatccgaccttcatccccgcggggcacaaggcgaatcagctcacggccaaacacatc
gacggggtcgcgggtggtacctggggtgagatcttcaacatcccgttgacggcgcatttc
atcggtggcgcacccatcggaaccgaccccgacaacggcgtcatcgatccgtaccaccgg
gtgttcaactacccgaacctgcacgtcgtggacggtgccgccatcacggccaacctcggg
gtgaacccgtcgctgaccatcgccgctcaggccgagcgcgcgttctcgttctggccgaac
aagggtgaggccgatccgcgccccgatcagcgtgaggggtacaagcggatcgcgcccgtc
gctccgaagaatccggtggtgcccgcggacgcgccgggagcgctgcggttgccgatcact
cccaagtga

DBGET integrated database retrieval system