KEGG   Saccharomonospora viridis: Svir_04920Help
Entry
Svir_04920        CDS       T00980                                 

Definition
(GenBank) succinyl-CoA synthetase (ADP-forming) beta subunit (EC:6.2.1.5)
  KO
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
svi  Saccharomonospora viridis
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:svi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Svir_04920
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Svir_04920
   00640 Propanoate metabolism
    Svir_04920
   00660 C5-Branched dibasic acid metabolism
    Svir_04920
Enzymes [BR:svi01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Svir_04920
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
488239..489408
Genome map
AA seq 389 aa AA seqDB search
MDLYEYQAKELFAAHGVPVLPGTVVSEAEEARRAAEEIGGQVVVKAQVKTGGRGKAGGVK
LAADPDEAAEKARAILGLDIKGHVTRRVLVTEASEIAEEYYFSFLLDRANRTFLAMASAE
GGMEIEQLAAERPEALAKVPIDPLTGVDLDKAREIVTKANFPEVVREKAAEVIVKLWETF
VSEDATLVEVNPLVRDPKDEIIALDGKVTLDDNAAFRQPKHADLVDVEAEDPLEAKAKAK
GLNYVKLDGQVGIIGNGAGLVMSTLDVVAYAGEKHGGVRPANFLDIGGGASAEVMAAGLE
VILGDPDVKSVFVNVFGGITACDAVANGIVEALKILGDNATKPLVVRLDGNNVEEGRRIL
TEAAHPLVTLVDTMDSAADKAAELAAAGA
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
gtggacctctacgagtatcaggcgaaggagcttttcgctgcccacggcgtacccgtactc
ccggggaccgtggtcagcgaggccgaggaagcccgccgggcggctgaggagatcggcggc
caggtggtggtcaaagctcaggtgaagacaggcggccgaggtaaggccggtggcgtgaag
ctcgccgccgacccggacgaggcggcggagaaggcccgagcgatcctcggactggacatc
aagggacatgtgacgcgccgggtgttggtgaccgaggcgtccgagatcgccgaggagtac
tacttctcgttcctgctcgatcgggccaaccgcaccttcttggccatggcctccgccgag
ggcggcatggagatcgagcagctcgccgccgagcgccccgaggcgctggcgaaggtcccg
attgacccgctgaccggggtcgacctcgacaaggcgcgcgagatcgtcaccaaggccaac
ttccccgaggtcgtgcgggagaaggccgccgaggtgatcgtcaagctgtgggagacgttc
gtctccgaggacgccaccctggtcgaggtgaacccgctggtgcgggacccgaaggacgag
atcatcgccctcgacggcaaggtgacgctcgacgacaacgcggcgttccggcagccgaag
cacgccgacctcgtcgatgtcgaggccgaggacccgttggaggccaaggccaaggccaag
ggcctcaactacgtcaagctcgacggtcaggtcggcatcatcggtaacggtgccggtctg
gtcatgtccacgctggacgtcgtggcctatgcgggcgagaagcacggcggggtgcgcccg
gcgaacttcctcgacatcggcggtggcgcgtcggccgaggtcatggcggccggactcgag
gtcatcctcggggacccggacgtcaagagcgtgttcgtcaacgtcttcggcggtatcacc
gcgtgcgacgcggtggccaacggcatcgtcgaagcgctgaagatcctcggggacaacgcc
accaagccgctggtcgtgcggcttgacggcaacaacgtcgaggagggccgccggatcctg
accgaggcggcgcatccgctggtgacgttggtggacacgatggacagcgcggccgacaaa
gccgccgagttggctgcggcaggtgcgtga

DBGET integrated database retrieval system