KEGG   Saccharomonospora viridis: Svir_05290Help
Entry
Svir_05290        CDS       T00980                                 

Definition
glycosidase
Organism
svi  Saccharomonospora viridis
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
532974..534413
Genome map
AA seq 479 aa AA seqDB search
MFQRVFAVVLLVSALLTLPVRTTPPADAAPPGERDVIATLFQWNWNSVARACHEQLGPNG
YGAVQVSPPTEHVVLGDDGYPWWQDYQPVSYKLESRRGTRAEFANMVNACHDAGVKVYVD
VVVNHMSGQDECGTGSAGSEYCHYEYPEAGYGYDDFHHCGRNGDDNIVDYHDRYEVQNCE
LVNLADLATESETVRDRIGAYLNDLLDLGVDGFRVDAVKHIPAEDVAAILSRLRSPAYIY
QETLYGEGEPITPDEYLDNGDVYDGRYARDIARIFNSEKLAYLRDFGTAVPSDRIVVFID
NHDSQRGGETLTYADGARYSLANAFMLAWPVGTPKVNSSFTFDDYDAGPPSDAAGNTTDA
TCDSGAWQCEHDWQPIRNMVGFHNEVRGEPVVHWWDNGNDTIAFGRGTKGYVVLNDESEP
VTGRSFHTGLPEGTYCDVLHGDVVNGACTGPTYTVDAAGWFRADIGAHDGVALHVGARV
NT seq 1440 nt NT seq  +upstreamnt  +downstreamnt
atgttccaacgtgtcttcgccgtggtccttttggtgtccgccttgctcaccctgccggtc
cggacgacaccaccggccgatgcggcaccacccggcgaacgcgacgtcatcgccacgctg
ttccagtggaattggaacagcgtcgcccgcgcctgccacgagcaactggggcccaacggc
tacggcgcggtccaggtgtccccgcccacggaacacgtcgtcctcggcgacgacggctac
ccgtggtggcaggactatcagccggtctcctacaaactggaaagccgacgcggcacccgc
gccgaattcgcgaacatggtcaacgcctgccacgacgccggcgtgaaggtgtacgtcgac
gtggtcgtcaaccacatgagcggccaggacgaatgcggcacgggcagcgcgggatcggag
tactgccactacgagtaccccgaagcgggatacggctacgacgatttccaccactgcggt
cgtaacggcgacgacaacatcgtcgactaccacgaccggtacgaagtgcagaactgcgaa
ctcgtcaacctcgccgacctcgccaccgaatccgaaaccgtacgagaccggatcggcgcc
tacttgaacgacctactcgacctcggagtggacggattccgcgtcgacgcggtcaagcac
atccccgccgaggacgtcgcggccatcctgagccgcctgcgctcgcccgcctacatctac
caggagacgctctacggggaaggcgaaccgatcaccccggacgagtacctcgacaacggt
gacgtgtacgacggtcggtacgcccgcgacatcgcgcgcatcttcaactccgagaaactg
gcgtacctgcgggacttcggcaccgccgtgccctcggaccggatcgtggtgttcatcgac
aaccacgacagccaacgcggcggcgagaccctgacctatgccgacggggcccggtactcg
ctggccaacgcgttcatgctggcctggccggtgggcacacccaaggtgaacagcagcttc
acgttcgacgactacgacgccggcccaccgagcgatgcggccggcaacaccaccgacgcc
acctgtgactcgggggcgtggcagtgcgaacacgactggcagccgatccgcaacatggtc
gggttccacaacgaggtgcgcggcgagccggtggtgcactggtgggacaacggcaacgac
accatcgctttcggacgcggcaccaagggttacgtggtgctcaacgacgagtccgagccg
gtgaccggacgctccttccacaccgggctgcccgagggcacctactgcgacgtgttgcac
ggtgatgtcgtcaacggtgcctgcaccggacccacctacacggtggacgcagccggctgg
ttccgcgccgacatcggcgcccacgacggtgtcgcattacacgtcggcgctcgcgtatga

DBGET integrated database retrieval system