KEGG   Saccharomonospora viridis: Svir_05340Help
Entry
Svir_05340        CDS       T00980                                 

Definition
endo-1,4-beta-xylanase (glycosyl hydrolase family 10)
Orthology
K01181  
endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
svi  Saccharomonospora viridis
Brite
Enzymes [BR:svi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.8  endo-1,4-beta-xylanase
     Svir_05340
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
538818..540191
Genome map
AA seq 457 aa AA seqDB search
MSTAHQRRSGLRRAGTRIRKVVAAVAVGAVTAGGLVAAAGTASAQTTLGDAAAAQGRYFG
TAVAVDRLGEPDYTATLNREFNSITAENSWKWESLQPSPGYFDFSTADRIAEHARQQGME
LRGHTLVWHSQLPSWVENIGSADELRAVMRNHITTVMEHYKGQVRSWDVVNEAFEDGNSG
ARRNSVFQRVLGDSWIEEAFWIAREADPNATLCYNDYNTDAWNTAKTQAVYNMVADFVSR
GVPIDCVGFQAHFNSGNPVPENYHITLQNFADLGVEVQLTELDIAGSGASQAEQYAGVTL
ACLAVPQCTGITVWGVTDKYSWRAEDTPLLFDGNYNPKQAYYAVLETLGGSGGGGGGDGA
CTVTYEETERWGDRFNGRVTVRAGDEAISSWSTTVTVHPPQRISATWNGDPSWDASGNVM
TMRSNSGLPAGGQTSFGFTVMANGNWTAPILGSCVAS
NT seq 1374 nt NT seq  +upstreamnt  +downstreamnt
atgagcacggcacatcaaaggcgatccgggctccgacgggccgggacccggatcaggaaa
gtcgtcgctgcggtcgcggtcggtgcggtgaccgcgggtgggctcgtcgccgccgccggc
acggcgagtgcacagaccactctcggtgacgccgccgcagcacagggccgttacttcggc
accgcggtcgcggtcgacagactcggcgaacccgactacacggccacgctcaaccgggag
ttcaacagcatcaccgccgagaactcatggaagtgggagagcctccaaccctcacccgga
tacttcgacttcagcaccgccgaccgcatcgccgaacacgcgcgccagcaaggcatggaa
ctgcgcggacacaccctggtctggcattcacagttgcccagctgggttgagaacatcggg
tccgccgacgaactccgggcggtgatgcgcaatcacatcaccaccgtgatggagcactac
aagggacaggtccgctcctgggacgtggtgaacgaggcgttcgaggacggcaacagcggc
gcccgtcgcaactcggtgttccagcgtgtcctcggtgacagctggatcgaggaggcgttc
tggatcgcccgcgaggccgacccgaacgccacgctctgctacaacgactacaacaccgac
gcctggaacacggcgaagacgcaggccgtgtacaacatggtggccgacttcgtcagccgt
ggcgtgccgatcgactgtgtcggtttccaggctcacttcaacagcggcaacccggtgccg
gagaactaccacatcaccctgcagaacttcgccgacctcggggtggaggtccagctcacc
gagctggacatcgcgggatcgggcgcgtcccaggcggaacagtacgccggcgtcaccctg
gcctgcctggccgtgccccagtgcaccggcatcacggtctggggggtgaccgacaagtac
tcctggcgcgcggaggacacgccgttgctgttcgacggcaactacaaccccaagcaggcc
tactacgccgtgctggaaaccctcggcggttccggcggcggaggcggtggtgacggcgcc
tgcaccgtgacctacgaggagaccgagcggtggggcgaccggttcaacggccgggtcacc
gtccgcgcgggcgatgaggcgatcagctcgtggagcaccaccgtcaccgtgcacccgccg
cagcggatctcggcgacctggaacggcgatccgagttgggatgccagcggcaacgtcatg
acgatgcggtcgaacagtggtctacccgcgggtggacagacgagcttcggtttcaccgtc
atggcgaacggtaactggacggcaccgatcctgggttcctgtgtcgcctcctga

DBGET integrated database retrieval system