KEGG   Saccharomonospora viridis: Svir_05370Help
Entry
Svir_05370        CDS       T00980                                 

Definition
(RefSeq) succinate dehydrogenase subunit D
  KO
K00242  
succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
svi  Saccharomonospora viridis
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:svi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Svir_05370
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Svir_05370
   00650 Butanoate metabolism
    Svir_05370
  Energy metabolism
   00190 Oxidative phosphorylation
    Svir_05370
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(542900..543316)
Genome map
AA seq 138 aa AA seqDB search
MAEALTLDKPRSPRRPAARRSNFELYSWLFMRISGLLLVVLVLGHLFIMNILDGGVHRIN
FAFVAGRWSSPFWQFWDLTMLWLAMIHGGNGLRTVIEDYARKESTRFWLKMVLYVATVVI
LLLGTLVIFTFDPNIPAD
NT seq 417 nt NT seq  +upstreamnt  +downstreamnt
atggctgaggcactgactctcgacaagccgcgctctcctcgcaggcccgcggctcggcgc
agcaacttcgagctctacagctggttgttcatgcgcatctccggcctgctgctcgtagtg
ctggtgctcggccacctgttcatcatgaacatcctcgacggcggtgtgcaccggatcaac
ttcgcgttcgtcgccggccgctggtcctctccgttctggcagttctgggacctgacgatg
ctctggctggcgatgatccacggcggtaacgggctgcgcacggtcatcgaggactacgca
cgtaaggaaagcacccgcttctggctgaagatggtgctgtacgtggccacggtggtgatc
ctgctgctcggcacactggtgatcttcaccttcgacccgaacatcccggctgactga

DBGET integrated database retrieval system