KEGG   Saccharomonospora viridis: Svir_05440Help
Entry
Svir_05440        CDS       T00980                                 

Gene name
deoA
Definition
thymidine phosphorylase (EC:2.4.2.2)
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
svi  Saccharomonospora viridis
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:svi00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Svir_05440 (deoA)
Enzymes [BR:svi01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     Svir_05440 (deoA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
549779..551095
Genome map
AA seq 438 aa AA seqDB search
MTGEPFAAVDVIRTKRDGAALSDEQIRWVVDAYTRGVVADEQMAALAMAILLRGMDRAEI
ACWTGAMIDSGERLSLRCSRPLVDKHSTGGVGDKITLPLAPLVATCGAAVPQLSGRGLGH
TGGTLDKLEAIPGWRAELSADEISRQLEDVGAVVCATTPTLAPADRKLYALRDVTATVDS
VPLIASSIMSKKIAEGVDRLVLDVKTGSGAFMKTREQARELATTLVEIGAAHGVATTAVL
TAMDTPLGSAVGNAVEVAEAVDVLRGGGPADVVELTVALAREMLALAGLSDVDPARVLAS
GQAYETWCRMIRAQGGDPEAALPEPAHVHVVEASEAGTMTRLDAYGVGVVAWRLGAGRAR
KDDPVQPAAGVRCLVKPGQRVEVGQPLFELHTDTPEAVAAVLPTLRAAYDIDGHETAPAA
LQARGGVVLERVVSGASG
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
atgacgggcgaaccattcgccgcggtcgatgtcatcaggaccaaacgcgacggtgcggcg
ttgagcgacgaacagatccgttgggtcgtcgacgcctacacgcgtggcgtggtcgccgat
gagcagatggcggcgttggccatggcgatcctgctgcgcgggatggaccgggccgagatc
gcgtgctggaccggcgccatgatcgactcgggggagcggctgtcgctgcgttgttcccga
ccgctcgtggacaagcattcgaccggcggcgtcggcgacaagatcacgttgccgttggcg
ccgctcgtggcgacgtgtggggccgccgtgccgcagctgtccggacgcggactcggccac
accggcggcacgttggacaaactggaggccatcccgggatggcgggccgaattgtcggcc
gacgagatcagccgtcagctggaggacgtgggtgccgtcgtctgtgccacgaccccgacg
ttggcgcccgccgaccgcaagctgtacgcgttgcgcgacgtcaccgccaccgtcgactcg
gtaccgctgatcgcgagctcgatcatgagcaagaagatcgccgagggtgtggatcggctg
gtgctcgacgtcaaaaccggctccggggcgttcatgaagacccgtgagcaggcccgggaa
ctggccacgaccctggtcgagatcggcgccgctcacggggtggccaccacggccgtgctg
accgccatggacacccccttggggtccgccgtcggcaacgccgtcgaggtggccgaggcc
gtggacgtccttcggggaggcggtcccgcggacgtcgtcgaactcaccgtggccctggcc
cgcgagatgttggcgctcgcgggattgtccgatgtcgacccggcacgtgtactcgcctcg
ggtcaggcgtacgagacctggtgccgcatgatccgcgcacagggcggtgatcccgaggcg
gcactgcccgaacccgctcacgtgcacgtcgtggaggcctccgaggcgggcaccatgacg
cggctggacgcctacggcgtgggtgtggtcgcgtggcggttgggagcgggcagggcccgc
aaggacgaccccgtgcagccggccgcgggcgtgcggtgtctggtcaagccggggcagcgg
gtcgaagtcggccagccgctgttcgaactgcacaccgacactcccgaggccgtggcggcg
gttctgccgacgttgcgggccgcgtacgacatcgacggacacgaaacagcccccgccgcc
ttgcaggcgcgcgggggcgtcgtactggagcgggtggtgagcggcgcgtcggggtga

DBGET integrated database retrieval system