KEGG   Saccharomonospora viridis: Svir_05440Help
Entry
Svir_05440        CDS       T00980                                 

Definition
(GenBank) thymidine phosphorylase
  KO
K00758  thymidine phosphorylase [EC:2.4.2.4]
Organism
svi  Saccharomonospora viridis
Pathway
svi00240  Pyrimidine metabolism
svi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:svi00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Svir_05440
Enzymes [BR:svi01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     Svir_05440
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glycos_transf_3 PYNP_C Glycos_trans_3N Biotin_lipoyl Biotin_lipoyl_2
Motif
Other DBs
NCBI-ProteinID: ACU95618
UniProt: C7MUQ5
Position
549779..551095
Genome map
AA seq 438 aa AA seqDB search
MTGEPFAAVDVIRTKRDGAALSDEQIRWVVDAYTRGVVADEQMAALAMAILLRGMDRAEI
ACWTGAMIDSGERLSLRCSRPLVDKHSTGGVGDKITLPLAPLVATCGAAVPQLSGRGLGH
TGGTLDKLEAIPGWRAELSADEISRQLEDVGAVVCATTPTLAPADRKLYALRDVTATVDS
VPLIASSIMSKKIAEGVDRLVLDVKTGSGAFMKTREQARELATTLVEIGAAHGVATTAVL
TAMDTPLGSAVGNAVEVAEAVDVLRGGGPADVVELTVALAREMLALAGLSDVDPARVLAS
GQAYETWCRMIRAQGGDPEAALPEPAHVHVVEASEAGTMTRLDAYGVGVVAWRLGAGRAR
KDDPVQPAAGVRCLVKPGQRVEVGQPLFELHTDTPEAVAAVLPTLRAAYDIDGHETAPAA
LQARGGVVLERVVSGASG
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
atgacgggcgaaccattcgccgcggtcgatgtcatcaggaccaaacgcgacggtgcggcg
ttgagcgacgaacagatccgttgggtcgtcgacgcctacacgcgtggcgtggtcgccgat
gagcagatggcggcgttggccatggcgatcctgctgcgcgggatggaccgggccgagatc
gcgtgctggaccggcgccatgatcgactcgggggagcggctgtcgctgcgttgttcccga
ccgctcgtggacaagcattcgaccggcggcgtcggcgacaagatcacgttgccgttggcg
ccgctcgtggcgacgtgtggggccgccgtgccgcagctgtccggacgcggactcggccac
accggcggcacgttggacaaactggaggccatcccgggatggcgggccgaattgtcggcc
gacgagatcagccgtcagctggaggacgtgggtgccgtcgtctgtgccacgaccccgacg
ttggcgcccgccgaccgcaagctgtacgcgttgcgcgacgtcaccgccaccgtcgactcg
gtaccgctgatcgcgagctcgatcatgagcaagaagatcgccgagggtgtggatcggctg
gtgctcgacgtcaaaaccggctccggggcgttcatgaagacccgtgagcaggcccgggaa
ctggccacgaccctggtcgagatcggcgccgctcacggggtggccaccacggccgtgctg
accgccatggacacccccttggggtccgccgtcggcaacgccgtcgaggtggccgaggcc
gtggacgtccttcggggaggcggtcccgcggacgtcgtcgaactcaccgtggccctggcc
cgcgagatgttggcgctcgcgggattgtccgatgtcgacccggcacgtgtactcgcctcg
ggtcaggcgtacgagacctggtgccgcatgatccgcgcacagggcggtgatcccgaggcg
gcactgcccgaacccgctcacgtgcacgtcgtggaggcctccgaggcgggcaccatgacg
cggctggacgcctacggcgtgggtgtggtcgcgtggcggttgggagcgggcagggcccgc
aaggacgaccccgtgcagccggccgcgggcgtgcggtgtctggtcaagccggggcagcgg
gtcgaagtcggccagccgctgttcgaactgcacaccgacactcccgaggccgtggcggcg
gttctgccgacgttgcgggccgcgtacgacatcgacggacacgaaacagcccccgccgcc
ttgcaggcgcgcgggggcgtcgtactggagcgggtggtgagcggcgcgtcggggtga

DBGET integrated database retrieval system