KEGG   Saccharomonospora viridis: Svir_06290Help
Entry
Svir_06290        CDS       T00980                                 

Definition
succinyl-diaminopimelate desuccinylase
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
svi  Saccharomonospora viridis
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:svi01230]
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:svi00300]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
645378..646454
Genome map
AA seq 358 aa AA seqDB search
MPSLDLRSDPVDLTAALVDIESVSGAEAGIADAVEAALRAQAPHLEVVRNGDAVLARTNL
GRPSRIVFAGHLDTVPVNDNLPSRRTGSGDDEVLHGLGSVDMKGGDAVFLHLAATLPEPR
HDVTFVFYDCEEVEAERNGLGRIERELPEWLRGDLAVVGEPSNAVIEAGCQGTMRVELRV
EGVRAHTARAWMGSNAIHALAEPLRRLAEYEARVVEIDGLTYREGLQAVRIEGGVAGNVV
PDSAVLTVNHRFAPDVSPEQAEARLRKVFDGYELTVVDCSPGALPGLSAPAAAELVAAAG
GRVAAKLGWTDVARFAALGMPAVNFGPGDPTLAHTKQEQVRVVEIRRVAEVLRSLLSG
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atgccctcgcttgacctgcgttccgatcccgtcgatctcaccgccgcgctcgtggacatc
gagagtgtgtccggggccgaggccggcatcgccgatgccgtggaggccgcactgcgtgct
caggcaccgcacctggaggtggtgcgcaacggggacgccgtgctggccaggaccaacctg
ggtaggccgtcccgcatcgtgttcgccggtcatctcgacaccgtgcccgtcaacgacaac
ctgccgtccaggcgcaccggttccggtgacgacgaggtgctgcacggcctcggcagtgtc
gacatgaagggtggtgacgccgtgttcctgcacctcgcggcgaccctgccggagccgagg
cacgacgtcacgttcgtgttctacgactgtgaggaggtcgaggccgagcgcaacggcctg
ggccgcatcgaacgtgaactgcccgagtggttgcgcggcgacctcgccgtcgtgggcgaa
ccgtcgaacgcggtgatcgaggcgggctgccagggcaccatgagggtcgaattgcgtgtg
gaaggtgtccgggcccacaccgcgcgggcgtggatgggttcgaacgccatccacgcgctg
gccgaaccgttgcgtcggctcgcggagtacgaggccagggtcgtggagatcgacggcctc
acctaccgggaggggctacaggcggtacggatcgaaggtggggtggcgggcaacgtcgta
cccgactccgccgtcctgaccgtgaaccaccgtttcgcgcccgacgtgtcgcccgagcag
gccgaggcccgtctgcgcaaggtgttcgacggctacgagctcaccgtcgtcgactgttca
cccggagcgttgccgggcctgtccgcgccggcggccgcggaactcgtcgccgccgcggga
ggacgggtcgcggccaaactcggatggaccgacgtggcccggttcgccgcgctcggcatg
cccgccgtcaacttcgggcctggcgatccgactctggcccacaccaaacaggagcaggtc
cgagtggtggaaattcgccgcgtcgcggaggtgcttcgttcactgttgtccgggtga

DBGET integrated database retrieval system