KEGG   Saccharomonospora viridis: Svir_06860Help
Entry
Svir_06860        CDS       T00980                                 

Definition
lysophospholipase L1-like esterase
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
svi  Saccharomonospora viridis
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:svi00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    Svir_06860
Enzymes [BR:svi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     Svir_06860
   3.1.2  Thioester hydrolases
    3.1.2.-  
     Svir_06860
Lipid biosynthesis proteins [BR:svi01004]
 Fatty acid synthase
  Component type
   Svir_06860
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
701593..702348
Genome map
AA seq 251 aa AA seqDB search
MGCAGRAWVRVGCVVLVVTGFVSACFAPNATTAAATTWCGDRSSIVVLGDSHSTGWGLPD
YTGNGDYAQTEAGWVSTLKRRASTEWGTVTTVLARNGATAADFHPGGRWPETAAAIDTVG
DLHPPLVVIALGGNEFAQDMHPARFDEHYRGLVHEVSRVSPRTTVLLVMGPEMGARLVPD
PTHSWNAYVGVAEAVAADEGVGLLDLGEYLPAGGTAEAEGLYLPDDAHLTAAGHRVVHAA
VWTRLSMWCGA
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
gtgggttgtgcggggcgggcctgggtccgggtcggttgtgtggtgctggtggtgacggga
ttcgtgtcggcgtgttttgctccaaacgcgactaccgccgccgcgacgacatggtgtggg
gaccggtcgtcgatcgtcgtgctcggcgactcccacagcacgggctggggcctgcccgac
tacaccgggaacggggactacgcgcagacggaggcgggctgggtgtcgacgttgaagcgt
cgagcctccactgaatggggcaccgtcaccacggtgctggcccgcaacggtgcgacggcg
gccgacttccacccaggtgggcgatggccggagacggcggccgcgatcgacacggtgggt
gatctccaccccccactcgtggtcatcgcgctgggcggcaacgagttcgcccaggacatg
caccccgctcggttcgacgagcactaccgcggactcgtgcacgaggtgtcgcgggtgtcc
ccgcgcacgaccgtgctgttggtgatgggaccggagatgggggcgcggctggtgccggac
ccgacgcactcgtggaacgcctacgtcggcgtggccgaggccgtcgccgccgacgaaggg
gtcgggttgctcgacctcggtgagtatctgcccgcaggtggcacggccgaggcggagggg
ctgtacctgccggacgacgcccacctgacggccgcggggcatcgcgtcgtccacgccgcc
gtgtggacgcgattgtcgatgtggtgcggggcgtga

DBGET integrated database retrieval system