KEGG   Saccharomonospora viridis: Svir_09260Help
Entry
Svir_09260        CDS       T00980                                 

Definition
(GenBank) arginase family hydrolase, arginase/agmainase/formiminoglutamate hydrolase
  KO
K01476  arginase [EC:3.5.3.1]
Organism
svi  Saccharomonospora viridis
Pathway
svi00220  Arginine biosynthesis
svi00330  Arginine and proline metabolism
svi01100  Metabolic pathways
svi01110  Biosynthesis of secondary metabolites
svi01130  Biosynthesis of antibiotics
svi01230  Biosynthesis of amino acids
Module
svi_M00134  Polyamine biosynthesis, arginine => ornithine => putrescine
Brite
KEGG Orthology (KO) [BR:svi00001]
 Metabolism
  Amino acid metabolism
   00220 Arginine biosynthesis
    Svir_09260
   00330 Arginine and proline metabolism
    Svir_09260
Enzymes [BR:svi01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     Svir_09260
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-ProteinID: ACU95984
UniProt: C7MY36
Position
953231..954064
Genome map
AA seq 277 aa AA seqDB search
MRVHAVPQWQGAGWDGAPSRLPVGCEVLASLAEEVLGTPVSRVPVDHEGSPVERGVVNRA
ALLGNRPAQLMVLENPEGPVLTLGGDCASDLVPIGVARYRYGPKLGVLWFDAHADANTPD
TSPSGAFHGMVLRALLGEGDEDFVADPAVEPGRAVLVGTRSFDPAETEAVRAGVLRHVPP
PAEPADVVAAVRESGAERLYVHVDVDVLDPGEFSGTHYHEPGGLTVERLVACLDALAEFD
VVGAALTECTAQDRTEAAALIPVVRALHRSLSRAETR
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgtgcatgcggtgccgcaatggcagggagcggggtgggacggagcgccttctcgg
ttgcccgtcgggtgcgaggtactcgcctcgctcgccgaggaggtgctcggcacacccgtt
tcgcgggtgccggtcgaccatgagggttcccccgtcgaacgcggtgtggtcaaccgcgcc
gcgttgctcggaaaccgtcccgcgcagctcatggtgttggagaaccctgaaggtccggtg
ctgacgctcggcggggactgcgcgagcgacctcgtgccgatcggggtcgcccgctaccgc
tacgggccgaaactgggggtgctgtggttcgacgcgcacgccgacgccaacaccccggac
acctcaccgtccggcgcgttccacggcatggtgctgcgggcgctgctcggcgagggcgac
gaagacttcgtggccgaccccgccgtggagccgggacgtgccgtgctggtggggacgcgg
tcgttcgaccccgccgagacggaggccgtccgggccggggtgctccgccacgtgccaccc
cccgcggaaccggccgacgtcgtcgccgcggtacgcgagtccggggcggagaggctgtac
gtgcacgtcgacgtggacgtactcgaccccggggagttctcgggaacccactatcacgaa
cccggcggcctcaccgtcgagcgtctcgtcgcctgcctggacgcactcgccgagttcgac
gtcgtcggagcggcgctgactgagtgcacggcacaggaccgtacggaggccgccgcgctg
atccccgtggtgcgggcactgcaccgttcactgtcccgcgccgaaactcggtag

DBGET integrated database retrieval system