KEGG   Saccharomonospora viridis: Svir_09650Help
Entry
Svir_09650        CDS       T00980                                 

Definition
malate synthase
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
svi  Saccharomonospora viridis
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Class
Metabolism; Overview; Carbon metabolism [PATH:svi01200]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:svi00620]
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:svi00630]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
993811..995376
Genome map
AA seq 521 aa AA seqDB search
MRVLGPAVERGDEILTDEALEFLAGLHESFAATRDELLEARKRRREEAKRTGRLDFLPET
KHIRESEWKVAEAPPALRDRRVEITGPTDRKMTINALNSGAKVWLADLEDANTPHWRNVV
SGQVNLYDAVRKTIELTTEKKHYKLRDDIEHATIVVRPRGWHLDERNIEINGRKAVGALV
DFGLYFFHNAKELLKRGVGPYFYLPKMESHLEARLWNDVFTHAEKTLGIEHGTIRATVLI
ETIPAAFEMEEILYELREHASGLNAGRWDYLFSVIKYFRDAGEKFILPDRNSVTMTAPFM
RAYTELLVRTCHKRGAFAIGGMAAFIPSKDPEINEKAFAKVRDDKAREAGDGFDGSWVAH
PGMVELCREQFDKVLGDKPNQLDRLREDVSVTAEQLLDVASTEGRATKEGLRGAVDVGVR
YIASWLSGNGAAAIHNLMEDAATAEISRSQVWQWVRNGVELDTGEKVTEELVRSVLAEVR
DELAEQIPAETLSESVELFEQVALAEEFVDFLTLPAYERIQ
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
gtgcgcgtgctcggcccggctgtcgagcgtggcgacgaaatcctgacggacgaggcgttg
gagttcctcgccggtttgcacgagtccttcgctgctacgcgggacgagctgctggaggcc
aggaagcggcgccgggaggaggccaaacggaccggcaggctcgacttcctaccggagacc
aagcacatccgcgagtccgagtggaaggtcgccgaggccccgcccgcgttgcgcgaccgt
cgggtggagatcaccggccccaccgaccgcaagatgaccatcaacgcgttgaactccggc
gcgaaggtgtggttggccgacttggaggacgccaacaccccgcattggcgcaacgtcgtg
tcggggcaggtcaacctgtacgacgcggtccgcaagaccatcgaactcaccactgagaag
aagcactacaaactgcgtgacgacatcgagcacgccacgatcgtcgtgcgcccgcggggt
tggcacctggacgaacgcaacatcgagatcaacggccgtaaggccgtcggcgcgctggtt
gacttcggactgtacttcttccacaacgccaaggaactgttgaagcggggcgtgggcccg
tacttctacctccccaagatggagagccacctcgaggcccgcttgtggaacgacgtgttc
acccacgccgagaagacgctcggcatcgagcacggcaccatccgcgccaccgtgttgatc
gagacgattcccgccgcgttcgagatggaggagatcctctacgagctgcgggagcacgct
tccgggctgaacgcgggccggtgggactacctgttcagcgtcatcaagtacttccgtgac
gcgggggagaagttcatcctgcccgaccgtaacagcgtcacgatgacggcgccgttcatg
cgcgcctacaccgaattgttggtgcgtacctgccacaagcggggtgcgttcgcgatcggt
ggcatggccgcgttcattccgagcaaggaccccgagatcaacgagaaggcgttcgccaag
gtccgggacgacaaggcccgggaggcgggcgacggcttcgacggctcgtgggtggcgcac
ccgggcatggtcgagctgtgcagggaacagttcgacaaggtgctcggggacaagccgaac
cagctcgaccggctgcgggaggacgtgtccgtgaccgccgagcagctgctcgacgtggct
tcgaccgagggacgcgccaccaaggagggcctgcgtggcgcagtggacgtcggtgtgcgt
tacatcgcctcctggctgagcggtaacggcgcggcggccatccacaacctcatggaggac
gcggccaccgccgagatctcgcggtcgcaggtgtggcagtgggtgcgcaacggcgtcgaa
ctcgacaccggcgagaaggtcaccgaggagctggtgcgttcggtcctcgcagaggtgcgc
gacgaattggccgagcagatcccggcggagacactcagtgagtcggtggagctgttcgag
caggtggctctggccgaggagttcgtcgacttcctcaccctgcccgcctacgagcggatc
cagtga

DBGET integrated database retrieval system