KEGG   Saccharomonospora viridis: Svir_09650Help
Entry
Svir_09650        CDS       T00980                                 

Definition
malate synthase
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
svi  Saccharomonospora viridis
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:svi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Svir_09650
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Svir_09650
   00630 Glyoxylate and dicarboxylate metabolism
    Svir_09650
Enzymes [BR:svi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     Svir_09650
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
993811..995376
Genome map
AA seq 521 aa AA seqDB search
MRVLGPAVERGDEILTDEALEFLAGLHESFAATRDELLEARKRRREEAKRTGRLDFLPET
KHIRESEWKVAEAPPALRDRRVEITGPTDRKMTINALNSGAKVWLADLEDANTPHWRNVV
SGQVNLYDAVRKTIELTTEKKHYKLRDDIEHATIVVRPRGWHLDERNIEINGRKAVGALV
DFGLYFFHNAKELLKRGVGPYFYLPKMESHLEARLWNDVFTHAEKTLGIEHGTIRATVLI
ETIPAAFEMEEILYELREHASGLNAGRWDYLFSVIKYFRDAGEKFILPDRNSVTMTAPFM
RAYTELLVRTCHKRGAFAIGGMAAFIPSKDPEINEKAFAKVRDDKAREAGDGFDGSWVAH
PGMVELCREQFDKVLGDKPNQLDRLREDVSVTAEQLLDVASTEGRATKEGLRGAVDVGVR
YIASWLSGNGAAAIHNLMEDAATAEISRSQVWQWVRNGVELDTGEKVTEELVRSVLAEVR
DELAEQIPAETLSESVELFEQVALAEEFVDFLTLPAYERIQ
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
gtgcgcgtgctcggcccggctgtcgagcgtggcgacgaaatcctgacggacgaggcgttg
gagttcctcgccggtttgcacgagtccttcgctgctacgcgggacgagctgctggaggcc
aggaagcggcgccgggaggaggccaaacggaccggcaggctcgacttcctaccggagacc
aagcacatccgcgagtccgagtggaaggtcgccgaggccccgcccgcgttgcgcgaccgt
cgggtggagatcaccggccccaccgaccgcaagatgaccatcaacgcgttgaactccggc
gcgaaggtgtggttggccgacttggaggacgccaacaccccgcattggcgcaacgtcgtg
tcggggcaggtcaacctgtacgacgcggtccgcaagaccatcgaactcaccactgagaag
aagcactacaaactgcgtgacgacatcgagcacgccacgatcgtcgtgcgcccgcggggt
tggcacctggacgaacgcaacatcgagatcaacggccgtaaggccgtcggcgcgctggtt
gacttcggactgtacttcttccacaacgccaaggaactgttgaagcggggcgtgggcccg
tacttctacctccccaagatggagagccacctcgaggcccgcttgtggaacgacgtgttc
acccacgccgagaagacgctcggcatcgagcacggcaccatccgcgccaccgtgttgatc
gagacgattcccgccgcgttcgagatggaggagatcctctacgagctgcgggagcacgct
tccgggctgaacgcgggccggtgggactacctgttcagcgtcatcaagtacttccgtgac
gcgggggagaagttcatcctgcccgaccgtaacagcgtcacgatgacggcgccgttcatg
cgcgcctacaccgaattgttggtgcgtacctgccacaagcggggtgcgttcgcgatcggt
ggcatggccgcgttcattccgagcaaggaccccgagatcaacgagaaggcgttcgccaag
gtccgggacgacaaggcccgggaggcgggcgacggcttcgacggctcgtgggtggcgcac
ccgggcatggtcgagctgtgcagggaacagttcgacaaggtgctcggggacaagccgaac
cagctcgaccggctgcgggaggacgtgtccgtgaccgccgagcagctgctcgacgtggct
tcgaccgagggacgcgccaccaaggagggcctgcgtggcgcagtggacgtcggtgtgcgt
tacatcgcctcctggctgagcggtaacggcgcggcggccatccacaacctcatggaggac
gcggccaccgccgagatctcgcggtcgcaggtgtggcagtgggtgcgcaacggcgtcgaa
ctcgacaccggcgagaaggtcaccgaggagctggtgcgttcggtcctcgcagaggtgcgc
gacgaattggccgagcagatcccggcggagacactcagtgagtcggtggagctgttcgag
caggtggctctggccgaggagttcgtcgacttcctcaccctgcccgcctacgagcggatc
cagtga

DBGET integrated database retrieval system