KEGG   Saccharomonospora viridis: Svir_10030Help
Entry
Svir_10030        CDS       T00980                                 

Definition
3-hydroxybutyrate dehydrogenase
Orthology
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
svi  Saccharomonospora viridis
Pathway
Synthesis and degradation of ketone bodies
Butanoate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:svi00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    Svir_10030
  Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    Svir_10030
Enzymes [BR:svi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.30  3-hydroxybutyrate dehydrogenase
     Svir_10030
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1029483..1030235
Genome map
AA seq 250 aa AA seqDB search
MSTSSLTGRTALVTGGAKGIGRACVAALREAGAKVHLVDVDRASANDAADAYGAVAHVAD
LTDPAAIESLPRDVDILVNNAGVQHIAPIEEFPPERFVFLQQLMVTAPFLLMRHCLPAMY
ERGWGRIINISSVHGLVASPHKSAYVAAKHALEGLSKVAAIEGAPHGVTSNCVNPGYVRT
DLVANQVEAQAESRGISTDAVLDEVFLRRTAVKRLIEPEEVAALVLWLCGDDSGYLTGAS
IPLDGGWTAT
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaccagctcactgaccgggagaacagctctcgtcaccggaggcgcgaagggtatc
ggccgagcctgtgtcgcggctttgcgtgaagccggggccaaggtgcacctcgtcgatgtc
gatcgcgcctccgccaacgatgcggcggacgcgtacggcgccgtcgcacacgtggctgat
ctgaccgatccggccgccatcgagtcgctgcctcgcgacgtggacatcctcgtcaacaac
gcgggcgtgcagcacatcgcgcccatcgaggagttcccacccgagcggttcgtgttcctc
cagcagttgatggtcacggcgccgtttctgttgatgcgccactgcctgcccgcgatgtac
gaacgcgggtggggacgcatcatcaacatctccagcgttcacgggctggtcgccagcccc
cacaaatcggcctacgtcgcggcgaagcacgccctggagggactgtccaaggtcgccgcc
atcgaaggcgctccccacggtgtcaccagcaactgcgtcaaccccggctacgttcgcacc
gacctcgtcgccaaccaggtcgaggcgcaggcggaatcgcgggggatctccaccgacgcg
gtcctcgacgaggtgttcctccgccgtaccgccgtcaagcggctcatcgaacccgaagag
gtggcggccctggtcctgtggctgtgcggggacgactcgggttatctcaccggcgcgtcg
atcccgctcgacggtggctggacggccacctaa

DBGET integrated database retrieval system