KEGG   Saccharomonospora viridis: Svir_10490Help
Entry
Svir_10490        CDS       T00980                                 

Definition
(RefSeq) 2-oxoglutarate dehydrogenase E2 component
  KO
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
svi  Saccharomonospora viridis
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:svi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Svir_10490
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Svir_10490
  Amino acid metabolism
   00310 Lysine degradation
    Svir_10490
Enzymes [BR:svi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Svir_10490
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1078742..1080538)
Genome map
AA seq 598 aa AA seqDB search
MAYSVTLPELGESVTEGTVTRWLKQEGDRVEVDEPLLEISTDKVDTEVPSPVAGTLLRIV
AREDETVEVGGELAVIDDGSGGEADSGATAAAPSTPSEPSAPSAPSESQPAQPEPQAAAP
SAPSGAAAGTPVTLPELGESVTEGTVTRWLKQVGDTVEVDEPLLEISTDKVDTEVPSPVA
GTLLEITVGEDETVEVGAQLAVVGPAGAAPAPQAPAAQPEPEPQPAPAPQAPQAQPAPAP
QPAPQPEPQPKPAPAPQPAPSAPAPAPQQAPAAPAAPAKREGGSTPYVTPLVRKLAAEHG
IDLSTVKGTGVGGRIRKQDVLAAAEAKQQEAAKQQAPAAPATPSRPAPTAVSESEKAALR
GTVQKASRIRQITAAKTKESLQISAQLTQVHEVDVTKVAQLRQRAKAAFREREGVNLTFL
PFFAKATVEALKQHPNVNASYNEETKEITYHGSINLGIAVDTERGLLSVVIHDAGELSLS
GLAHRIADLAERARNNKVTPDELTGGTFTITNLGSNGALFDTPIIVQPQSGILGVGAVVR
RPVVVTDAEGNDTIAIRSMAYLPLTYDHRLIDGADAGRFLTTIKQRLEEGNFEDELGL
NT seq 1797 nt NT seq  +upstreamnt  +downstreamnt
atggcgtactccgtcacactgccggagctcggtgagagcgtcaccgagggcaccgtcacc
cggtggctgaagcaggagggtgacagggtggaggtcgacgagccgctgctcgagatctcc
accgacaaggtcgacaccgaagtaccttcgcccgtggcgggcacgttgctccggatcgtg
gcgcgtgaggacgagaccgtggaggtcggcggcgaactcgccgtgatcgacgacggttcg
ggcggcgaggccgacagcggtgcgaccgctgcggcgccctccacgccctccgagccctca
gctccttccgcaccgtcggagtcgcagccggcacagcccgagccgcaggccgcggccccg
tcggccccctccggcgccgcggcaggcacaccggtgacgctgccggagctcggtgagagc
gtcaccgagggcaccgtcacccggtggctgaagcaggtcggcgacacggtggaggtcgac
gagccactgctggagatctccaccgacaaggtcgacaccgaagtaccttcgcccgtggcg
ggcacgctgctcgagatcaccgtgggtgaggacgagaccgtggaggtcggcgctcagctg
gccgtcgtggggcccgccggcgccgctccggcaccgcaggcgcccgctgctcagcctgag
cctgagccgcagcccgcgcccgccccgcaggctccgcaggcacagcccgcccctgctccg
cagccggccccacagcctgagccgcagcccaagcccgcgcccgccccgcagccggctccg
agcgcacctgctccggcaccgcagcaggctccggccgccccggccgccccggccaagcgc
gagggcgggagcacgccgtacgtcacgccgctggtgcgcaagctcgctgccgagcacggc
atcgacctgagcaccgtcaagggcaccggtgtcggtggccgcatccggaagcaggacgtg
ctggccgccgcggaggccaagcagcaggaagccgccaagcagcaggctccggccgccccg
gccactccgtcccggcccgcgccgaccgcggtgtcggagtcggagaaggccgcgctgcgt
ggcacggtgcagaaggccagccgcatccgccagatcacggccgccaagaccaaggagtcg
ctgcagatctcggcccagctcacgcaggtgcacgaggtcgacgtcaccaaggtcgcgcag
ctgcggcagcgcgcgaaggcggcgttccgcgagcgcgagggtgtgaacctgacgttcctg
ccgttcttcgccaaggccacggtcgaggcgctcaagcagcacccgaacgtcaacgcctcc
tacaacgaggagacgaaggagatcacctaccacggctcgatcaacctcggcatcgccgtg
gacaccgagcgtggtctgctgtcggtggtcatccacgacgcgggtgagctgagcctgtcc
gggctggcccaccggatcgccgacctggcggaacgcgcccgcaacaacaaggtgaccccg
gacgagctcaccggcggcacgttcacgatcaccaacctcggcagcaacggcgcgctgttc
gacacgccgatcatcgtgcagccgcagtcgggcatcctgggcgtgggcgcggtcgtgcgg
cgtcccgtcgtggtcaccgacgccgagggcaacgacaccatcgcgatccgctcgatggcc
tacctgccgctgacctacgaccaccgtctcatcgacggtgcggacgcgggacggttcctc
acgacgatcaagcagcgtctggaggagggcaacttcgaggacgagctcggactctga

DBGET integrated database retrieval system