KEGG   Saccharomonospora viridis: Svir_10870Help
Entry
Svir_10870        CDS       T00980                                 

Gene name
hisD
Definition
histidinol dehydrogenase (EC:1.1.1.23)
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
svi  Saccharomonospora viridis
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:svi00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Svir_10870 (hisD)
  Amino acid metabolism
   00340 Histidine metabolism
    Svir_10870 (hisD)
Enzymes [BR:svi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     Svir_10870 (hisD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1119979..1121313
Genome map
AA seq 444 aa AA seqDB search
MLKRTDLRGRVPSPAQLRALLPRAEVDVDAVLHQVRPVVDAVRERGVDAVLDYTERFDAV
RPDRVRVPAREMESALASLDPVVREALEESIARARAVHADQRREDVTTRVVDGGTVTERW
VPVSRVGLYAPGGLAVYPSSVVMNVVPAQTAGVGSLVLCSPPQAEFGGLPHPTILAAAAL
LGVDDVWAVGGAQAVALLAYGGTDTDGTELEPVDMVTGPGNIYLTAAKRLLRGLIGIDSE
AGPTEIAILADDTADPAHVAADLISQAEHDTLAASVLVTTSEALADAVDEELRRRVAATK
HTERVEQALRGAQSGTVLVSTVDDGLRVVDAYAAEHLAIQTANAREVAARVRNAGAIFVG
PYSPVSLGDYCAGSNHVLPTGGFARHSSGLSVQSFLRGIHVVDYNEQALRDVADKVVALA
NAEDLPAHGEAVMARTGRLPGSDA
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
atgttgaagcgcaccgacctgcgaggtcgcgtcccgtcccccgcgcaactgcgcgcgttg
ctgccgcgcgccgaggtggatgtggacgcggtactgcatcaggtgcggccggttgtcgac
gccgtgcgggaacgtggtgtcgacgcggtactcgactacaccgaacgtttcgacgcggtc
cgtcccgaccgcgtgcgggtgcccgcccgggagatggagagcgcgttggcctccttggac
ccggtggtgcgggaagcgttggaggagtcgatcgcccgggcgcgcgccgtgcacgccgat
cagcgtcgtgaggacgtcaccacccgggtcgtcgacggcggcaccgtcacggagcgttgg
gtgcccgtgtcccgggtcggtctgtacgcgccgggcgggttggcggtgtacccgtcgagc
gtggtgatgaacgtcgtgcccgcccagacggcgggtgtgggctcgttggtgctgtgctcg
ccgccgcaggcggagttcggcggcctgccgcacccgacgatcctcgcggcggccgcgttg
ctcggggtcgacgacgtgtgggcggtcggcggcgcgcaggccgtggcactgctggcctac
ggcgggaccgacaccgacggcacggagctggagccggtcgacatggtgaccggtccgggc
aacatctatctgaccgcggccaagcggctgctgcgtggattgatcggtatcgactccgag
gccggccccaccgagatcgcgatcctggccgacgacaccgccgaccccgcgcacgtggcg
gccgatctgatcagccaggccgagcacgacaccttggccgcgagcgtgctggtcacgacg
tcggaggcgttggcggacgcggtggacgaggagttgcgtcgtcgggtggccgccaccaag
cacaccgagcgggtggagcaggccctgcggggcgcgcagtccggcaccgtcctggtatcc
actgtggacgacgggttgcgggtggtggacgcctacgccgccgagcacctggcgatccag
accgcgaacgcgcgtgaggtggccgcgcgggtgcgcaacgcgggtgcgatcttcgtcggc
ccgtattccccggtgtcgctcggcgactactgcgccggttccaaccacgtactgcccacg
ggcgggttcgcgcggcattcgtcggggctgtccgtgcagagcttcctgcgcggtatccac
gtcgtcgactacaacgagcaggccctgcgcgacgtggcggacaaggtggtggcgctggcc
aacgccgaggacctgcccgcacacggcgaggccgtgatggcgcggaccggacgacttccc
gggagtgacgcgtga

DBGET integrated database retrieval system