KEGG   Saccharomonospora viridis: Svir_11500Help
Entry
Svir_11500        CDS       T00980                                 

Definition
Dihydropteroate synthase
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
svi  Saccharomonospora viridis
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:svi00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1182919..1183785)
Genome map
AA seq 288 aa AA seqDB search
MITLHCRGRVVERNRALVMAIVNRTPDSFYDRGSTYDLDAALRAVDAAVADGADIVDIGG
VKAGPGSEVSVAEEIRRVVPLVAAVRERHPDLLISVDTWRSEVGRSACEVGADILNDTWQ
SADPALAEVAAEFEAGYVCSHTGGAPPRTLPHRVSYPDVVAAVIEEVTGRAERLAAMGVP
RGGILIDPTHDFGKNTWHGLELLRRIRELTTTPWPVLLALSNKDFVGETLGAELHDRVDG
TLAATAVAAWEGAAVFRAHEVRRTRQVVDMVASIRGTRPPTLCLRGLT
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
gtgatcaccctgcactgtcgtgggcgcgtggtggagcggaaccgggcgcttgtcatggcg
atcgtcaaccggaccccggattcgttctacgaccgtggctccacctacgacctcgatgcc
gcactgcgggccgtggacgccgccgtcgccgacggcgcggacatcgtggacatcggcgga
gtgaaggcgggtcccggttcggaggtgtcggtcgccgaggagatccgccgagtcgtcccc
ctcgtggccgccgtccgcgaacggcatcccgacctgctcatcagcgtggacacgtggcgg
tcggaggtcggcaggtcggcgtgcgaggtgggcgcggacatcctcaacgacacgtggcag
tcggccgatcccgccttggccgaggtcgccgccgagttcgaggcgggatacgtgtgctct
cacaccggcggcgcgcccccacgcacgttgccgcaccgcgtgtcctaccccgacgtggtg
gccgcggtcatcgaggaggtcaccgggcgcgccgaacgtctcgccgcgatgggcgtcccc
cggggcggcatcctcatcgaccccacccacgatttcggcaagaacacctggcatggcctg
gaactgctgcgtcgtatccgagaactcaccaccaccccgtggccggtgttgctcgccctg
tccaacaaggatttcgtcggggagacactcggcgccgaattgcacgaccgcgtcgacggc
acgctcgcggccacggccgtcgcggcgtgggagggcgcggcggtgttccgagcccacgag
gtacgccggactcggcaggtcgtggacatggtggcgagcatcaggggaacccgacccccg
acgctgtgtcttcgtggcctgacctga

DBGET integrated database retrieval system