KEGG   Saccharomonospora viridis: Svir_11640Help
Entry
Svir_11640        CDS       T00980                                 

Definition
protein-L-isoaspartate carboxylmethyltransferase
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
svi  Saccharomonospora viridis
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1197810..1199093
Genome map
AA seq 427 aa AA seqDB search
MTTTCSTSTADAASVLREAMVRELREWGAIRSEPVEQAALTVPRHLFAPGEPIEAAYEPN
KPLVVKRDEQGLALSSLSATHIQVVMLEQARPEPGMRVPEVGSGGYNAVLIAEMVGESGT
VVSLDIDAEIVERARDCLKAAGYERVIVARGDAEYGYADGAPWDRIIVTAGAWDIPPAWI
EQLAPGGRIVVPLRMRGLTRSVVLEPDGDHLVSTDYHLCGFVPMQGAGRHDQRLIPLAGG
PEGPEVGLRVEEEQRLDVAGMRKALCAPAVQRWSGVDFDHVDELDFFIGMSAPVFGVLAA
RVSAVDSGLVDPAAKRGAPTLIRGASFAYRTARPVEGTERYETGVIAHGPEAVAVADEYV
ELLRRWDRDFRHRRPAARIEVFPAATPTSDLPKGRLIEKAHSRVVVSWPGTREGLLRHTG
ITHREGT
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atgacgacaacatgcagcaccagcaccgctgacgcagcgagcgttctccgcgaggccatg
gtgcgcgaactgcgcgagtggggcgcgatccgcagcgaaccggtcgaacaggcggcattg
acggtgccgcggcacttgttcgcgccgggcgagccgatagaggccgcctacgagccgaac
aaacctctggtagtcaagcgggacgaacaggggctggcgctcagctcgctgagtgcaacg
cacatccaggtggtcatgctggagcaggcccggccggaaccggggatgcgtgtgccggag
gtgggcagcggcggttacaacgccgtcctgatcgccgagatggtgggcgagtccggcacg
gtcgtctccctggatatcgacgccgagatcgtcgagcgggcccgcgactgtctgaaggcg
gccggatacgagcgggtcatcgtggcgcggggcgatgccgagtacggatacgccgacggg
gcaccgtgggaccggatcatcgtcacggccggggcctgggacatcccgccggcctggatc
gagcagctggcaccgggtggacgcatcgtcgtgccgttgcggatgcgcggattgacgcgc
tccgtcgtgctcgaacccgacggagaccacctcgtgagcacggactaccacctgtgcggg
ttcgtgccgatgcaaggtgccggaaggcatgaccagcgcctgatccctctcgccggcggg
cccgaggggccggaggtcgggttgcgagtggaggaggagcagcgactcgacgtcgccggg
atgcggaaagcgctttgcgcccctgctgtgcagcgttggtccggcgtcgatttcgatcac
gtcgacgaactcgacttcttcatcggaatgtcagcgccggtgttcggggtactggccgcc
cgggtctcggccgtcgacagcggcctggtggatccggcggctaagcgaggagcgcccacg
ttgatccgcggcgcgtccttcgcctatcgcacggcgcggcccgttgagggcaccgagcga
tacgagaccggggtgatcgcacacggcccggaggctgtggcggtcgccgacgagtacgtc
gagctgctgcggcgatgggatcgcgacttccgacaccggcggcctgccgcgcggatcgag
gtgttcccggcggcgacgccgaccagtgatctccccaaggggcgactcatcgagaaggcg
cacagccgggtcgtcgtctcctggccgggaacgcgggagggcctcttgcggcacacaggg
atcactcatcgggaaggtacgtga

DBGET integrated database retrieval system