KEGG   Saccharomonospora viridis: Svir_13280Help
Entry
Svir_13280        CDS       T00980                                 

Definition
(GenBank) fructose-2,6-bisphosphatase
Organism
svi  Saccharomonospora viridis
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1364823..1365449)
Genome map
AA seq 208 aa AA seqDB search
MTDLILVRHGETIWHHDNRYTGRSDVPLTERGHRQAEAFARWAATSPPHALWVSPLSRAR
DTAAPIAKATGLSMRIDERLVELDFGRGEGLTGAEMDEAFPEARRAFVADPVANHLPGGE
DPVHAAERMAACAADIVREHPNETVLVVGHSTAHRLLLCRLLGLPLSSYRRVFPVFRNCA
VTTVRWNGTDPAALIEYNVPPDHRAVAA
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
atgaccgatctgatcctcgtccggcacggggagaccatctggcaccacgacaaccgctac
accggccgcagtgacgtaccactgaccgagcggggccatcgacaggcggaagccttcgcc
cgctgggccgccacatccccaccgcacgcgctgtgggtgtcaccgctgagcagggcacgg
gacaccgcggcccccatcgcgaaggccaccggcctgtcgatgcggatcgacgagcggctg
gtggagctcgacttcggccggggggaagggctcaccggggcggagatggacgaggcgttc
cccgaggcccgtagggctttcgtggccgatccggtggcgaatcacctgcccggcggcgag
gatcccgttcacgccgcggagcgaatggccgcctgtgccgccgacatcgtgcgagaacat
cccaacgagacggtgctcgtggtcggtcactccaccgcgcaccggttgttgttgtgccga
ctgcttggacttcccttgagctcctatcgccgggtgttcccggtgttccggaactgcgcc
gtcaccacggtccgttggaacggcaccgatcccgcggcgctgatcgagtacaacgtccca
cccgaccaccgagccgtggccgcgtag

DBGET integrated database retrieval system