KEGG   Saccharomonospora viridis: Svir_14340Help
Entry
Svir_14340        CDS       T00980                                 

Definition
glutathione peroxidase (EC:1.11.1.12)
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
svi  Saccharomonospora viridis
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:svi00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    Svir_14340
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Svir_14340
Enzymes [BR:svi01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     Svir_14340
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1479434..1479934
Genome map
AA seq 166 aa AA seqDB search
MTQTALTDIGLHTLAGEPATLGGLGAKVLLVVNVASKCGLTPQYEGLERLHRRYVDRGFT
VVGFPCNQFAGQEPGSEEEIARFCSTTYGVSFPMFTKIEVNGPNRHPVYAELTRHPDADG
EAGDVQWNFEKFLIDDRGRVLARFRPRTEPESAEIIEAVETALARA
NT seq 501 nt NT seq  +upstreamnt  +downstreamnt
atgacccagaccgctctgaccgatatcggattgcacacgttggccggtgagcccgcgacc
ctcgggggcctgggagcgaaggtcctcctggtggtcaacgtcgcgtcgaaatgtggtctg
acaccccagtacgagggattggagcggttgcaccgacgttacgtcgaccgggggttcacc
gtcgtcgggttcccgtgcaaccagttcgccggtcaggagcccgggtcggaggaggagatc
gcccggttctgctcgaccacgtacggggtgagcttcccgatgttcaccaagatcgaggtc
aacgggccgaaccggcatcccgtgtacgccgaactgacccggcatcccgacgccgacggc
gaagcgggcgatgtgcagtggaatttcgagaagttcctcatcgacgaccggggccgtgtg
ctcgcgcggttccggcctcgcacggagccggagtcggccgagatcatcgaggcggtggag
accgcgttggcccgggcgtag

DBGET integrated database retrieval system