KEGG   Saccharomonospora viridis: Svir_14340Help
Entry
Svir_14340        CDS       T00980                                 

Definition
glutathione peroxidase (EC:1.11.1.12)
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
svi  Saccharomonospora viridis
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:svi00590]
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:svi00480]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1479434..1479934
Genome map
AA seq 166 aa AA seqDB search
MTQTALTDIGLHTLAGEPATLGGLGAKVLLVVNVASKCGLTPQYEGLERLHRRYVDRGFT
VVGFPCNQFAGQEPGSEEEIARFCSTTYGVSFPMFTKIEVNGPNRHPVYAELTRHPDADG
EAGDVQWNFEKFLIDDRGRVLARFRPRTEPESAEIIEAVETALARA
NT seq 501 nt NT seq  +upstreamnt  +downstreamnt
atgacccagaccgctctgaccgatatcggattgcacacgttggccggtgagcccgcgacc
ctcgggggcctgggagcgaaggtcctcctggtggtcaacgtcgcgtcgaaatgtggtctg
acaccccagtacgagggattggagcggttgcaccgacgttacgtcgaccgggggttcacc
gtcgtcgggttcccgtgcaaccagttcgccggtcaggagcccgggtcggaggaggagatc
gcccggttctgctcgaccacgtacggggtgagcttcccgatgttcaccaagatcgaggtc
aacgggccgaaccggcatcccgtgtacgccgaactgacccggcatcccgacgccgacggc
gaagcgggcgatgtgcagtggaatttcgagaagttcctcatcgacgaccggggccgtgtg
ctcgcgcggttccggcctcgcacggagccggagtcggccgagatcatcgaggcggtggag
accgcgttggcccgggcgtag

DBGET integrated database retrieval system