KEGG   Saccharomonospora viridis: Svir_15550Help
Entry
Svir_15550        CDS       T00980                                 

Definition
aspartate carbamoyltransferase (EC:2.1.3.2)
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
svi  Saccharomonospora viridis
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:svi00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Svir_15550
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Svir_15550
Enzymes [BR:svi01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     Svir_15550
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1596111..1597043
Genome map
AA seq 310 aa AA seqDB search
MRHLLSTDGLDAATATAILDTADELKRTLLGREVRKLPTLRGRTVITLFYENSTRTRVSF
EIAGKWMSADVVNVSAGGSSVGKGESLRDTALTLSAAGADCVVIRHPASGAAHRLAGWLA
ETGTSVINAGDGTHEHPTQALLDAATLRERLGGLEGRRVTIVGDVLHSRVARSNAHLLPL
LGAEVTLVAPPTLLPVGVESWPVTVSHDLDAALPATDAVMMLRVQAERMHGGFFPSAREY
AIAYGLNETRLKLLPEHAVVLHPGPMLRGMEIASAVADAPNAVITEQVRNGVHVRMAVLY
HLLAGEGEKS
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atgaggcatctgctgtccaccgacggtctcgacgccgctacggccacggcgatcctcgac
acggccgatgaactgaaacgcactctgttgggccgcgaggtccgcaaactacccacgctg
cgtgggcgcaccgtgatcaccttgttctacgagaactcgacccgcacccgggtgtcgttc
gagatcgcgggcaagtggatgagcgccgacgtggtgaacgtctccgcgggcggttcgtcg
gtcggcaagggtgaatccctccgggacaccgcgttgacgttgtcggccgcaggcgcggac
tgcgtggtcatccggcatccggcctccggtgccgctcatcggctcgcgggctggctggcc
gagacggggaccagcgtgatcaacgccggggacgggacgcacgagcatccgacgcaggcg
ttactcgacgccgccacgctgcgggagcgactcggcggccttgagggccgtcgcgtgacg
atcgtcggtgacgtgctccacagccgggtcgcgcggtcgaacgcgcatctgctgcccctg
ctcggcgcggaggtgacgttggtcgcaccaccgacgttgttgccggtgggagtggagtcg
tggccggtcaccgtgtcccacgatctcgatgccgccctgcccgccaccgacgcggtgatg
atgctgcgcgtgcaggccgagcgcatgcacggaggtttcttcccttcggcgcgggaatac
gcgatcgcgtacggattgaacgagacccggctgaaattgctgcccgaacacgccgtggta
ctgcacccgggaccgatgctgcgcgggatggagatcgcctcggcggtggccgacgcaccc
aacgcggtgatcaccgaacaggtccgtaacggtgtgcacgtgcggatggcggtgctctat
cacctgctggcgggggaaggggagaagtcgtga

DBGET integrated database retrieval system