KEGG   Saccharomonospora viridis: Svir_15890Help
Entry
Svir_15890        CDS       T00980                                 

Definition
(RefSeq) triosephosphate isomerase (EC:5.3.1.1)
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
svi  Saccharomonospora viridis
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:svi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Svir_15890
   01230 Biosynthesis of amino acids
    Svir_15890
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Svir_15890
   00051 Fructose and mannose metabolism
    Svir_15890
   00562 Inositol phosphate metabolism
    Svir_15890
Enzymes [BR:svi01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Svir_15890
Exosome [BR:svi04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Svir_15890
  Exosomal proteins of bladder cancer cells
   Svir_15890
  Exosomal proteins of melanoma cells
   Svir_15890
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1631171..1631956
Genome map
AA seq 261 aa AA seqDB search
MARKPLIAGNWKMNLNHLEAIALVQKIAFSLPEKYYEKVDVTVLPPFTDIRSVQTLVDGD
KLLLTYGAQDVSPHDSGAYTGDISAPMLAKLGCTYVVVGHSERREYHGETDELVNKKVRA
ALKHGLSPIVCVGEQLEVREAGGHIEHTTSQLIAALKGLKTEQVNNVVVAYEPVWAIGTG
RVATPSDAEEVCAALRTALADKYGADLAQRVRVLYGGSVKSSNVADLVKCDNVDGALVGG
ASLDGEEFTKLCALAAGGPLP
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atggcccgcaagccgctgatcgcaggcaactggaagatgaatctgaaccacctcgaggcc
atcgccctggttcagaagatcgccttctcgttgccggagaagtactacgagaaggtcgat
gtgacggtgcttccgccgttcaccgacatccgtagcgtgcagacactggtcgacggggac
aagctcctgctcacctacggggctcaggacgtgtcgccgcacgactccggtgcctacacc
ggcgacatctccgctccgatgctcgccaagctgggctgcacctatgtcgtggtcggccac
tccgagcggcgcgagtaccacggcgagaccgacgagctcgtgaacaagaaggtccgtgcc
gcgctcaagcacgggctgtcgccgatcgtgtgtgtcggcgagcagttggaggttcgggaa
gccggcggtcacatcgagcacaccacgtctcagctcatcgcggcgctgaaggggctcaag
accgaacaggtgaacaacgtggtggtggcctatgaacccgtgtgggccatcggcacgggc
cgtgtcgccaccccttccgacgccgaagaggtgtgtgccgcgttgcggacggcgctggcc
gacaagtacggtgccgacctcgcccagcgggtgcgggtgctctacggtggctcggtgaag
tcgagcaacgtggccgacctcgtcaagtgtgacaacgtcgacggagctctcgtgggtggt
gccagcctcgacggtgaggagttcacgaaactgtgtgctctcgcggcgggtggcccacta
ccgtga

DBGET integrated database retrieval system