KEGG   Saccharomonospora viridis: Svir_16070Help
Entry
Svir_16070        CDS       T00980                                 

Definition
Delta-9 acyl-phospholipid desaturase
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
svi  Saccharomonospora viridis
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Class
Metabolism; Overview; Fatty acid metabolism [PATH:svi01212]
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:svi01040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1652339..1653295)
Genome map
AA seq 318 aa AA seqDB search
MSSSTMPTSTGRRTGPKPLVGHERSTAQMIVLKTFLLIPFVALVAAIPFAWGWGLTWVDL
ALAAVFYTIGTLGVTVGYHRYFTHGAFKTTRPLRIALAIAGSMAVQGSVLFWVASHRRHH
AFADKEGDPHSPWLFGTSPWALLRGFWHAHMGWMFKREVTNYERFAPDLLSDKDLQVVNR
YFWLWIVLSLALPTLLGGLITWSWWGAVTAFFWAGLVRIAFSHHVTWSVNSICHLVGERP
FTSRDKATNFWPLAILSMGESWHNSHHADPTCARHGVLRGQIDISARLIWIFEKLGWAHN
VRWPKPERIAAKRAVPAA
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atgagcagcagcaccatgcccacgtccaccggacgacgcaccgggccgaagccccttgtc
gggcacgaacgctccaccgcacagatgatcgtgttgaagacattcctgttgatcccgttc
gtcgcgctggtcgcggcgatccccttcgcgtgggggtgggggttgacctgggtggacctc
gcgctcgccgcggtgttctacaccatcggcacactcggcgtcaccgtcggctatcaccgc
tacttcacgcacggagcgttcaagaccaccaggcccttacgcatcgctctcgccatcgcc
ggcagcatggccgtgcagggttcggtgctcttctgggtggcgagccatcgccggcaccac
gccttcgccgacaaagagggcgatccgcattccccgtggttgttcggcacctcaccgtgg
gcgctgctgcgtggtttctggcacgcgcacatgggttggatgttcaaacgcgaggtcacg
aactacgagcggttcgcacccgacctgttgtccgacaaggacctgcaggtcgtcaaccgt
tacttctggctgtggatcgtgctgagcctcgcactgcccaccctgctcggcgggctcatc
acgtggtcgtggtggggtgcggtgacggccttcttctgggccggactcgtgcgtatcgcg
ttctcccaccacgtcacgtggtcggtgaactcgatctgtcatctggtgggtgaacgcccg
ttcaccagcagggacaaggccacgaacttctggcctctggcgatcctgtcgatgggtgag
tcctggcacaacagccaccacgccgacccgacctgcgcccgacacggtgtcctgcgcggt
cagatcgacatctccgcgcgactgatctggatcttcgagaagttggggtgggcgcacaac
gtgcgctggcccaaaccggaacgaatcgccgccaaacgcgccgtaccggcggcgtag

DBGET integrated database retrieval system