KEGG   Saccharomonospora viridis: Svir_16630Help
Entry
Svir_16630        CDS       T00980                                 

Definition
(GenBank) transcriptional regulator/sugar kinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
svi  Saccharomonospora viridis
Pathway
svi00010  Glycolysis / Gluconeogenesis
svi00052  Galactose metabolism
svi00500  Starch and sucrose metabolism
svi00520  Amino sugar and nucleotide sugar metabolism
svi00521  Streptomycin biosynthesis
svi01100  Metabolic pathways
svi01110  Biosynthesis of secondary metabolites
svi01120  Microbial metabolism in diverse environments
svi01130  Biosynthesis of antibiotics
svi01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:svi00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Svir_16630
   00052 Galactose metabolism
    Svir_16630
   00500 Starch and sucrose metabolism
    Svir_16630
   00520 Amino sugar and nucleotide sugar metabolism
    Svir_16630
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Svir_16630
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    Svir_16630
Enzymes [BR:svi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Svir_16630
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK
Motif
Other DBs
NCBI-ProteinID: ACU96696
UniProt: C7MT59
Position
complement(1716847..1717854)
Genome map
AA seq 335 aa AA seqDB search
MPVSQTIGNSPPQPAVVALDVGGTFVKWLVADRTGVLRRGTTPTRAADGPERSFGVVLDT
VDTALAALPSTHTPVGIGLAVPGTVDERRGVCVYSENLGWRELPVVERVLRHTGLPVGFG
HDVRSAATAEWRLGAGRGIADQVYVSVGTGLAAALLLDGRLVVSGGYAGEIGHGGTLEGE
PCTCGGRGCAETVASAAAIARRYTASTGIPVDGARDVLARAREGDAVAHRVWEDAVEVLG
SVVADLIRVTGVARIVIGGGLVHAGEALLTPLRDRVRERLTVHPTAHILPAVLGGAAGSW
GAALLGWEAADIDLDPILTAYADAVRTRSEPGAAE
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
gtgcccgtgtcccagacgatcggtaattcgccacctcagcccgccgtcgtggccctcgac
gtgggcgggaccttcgtcaaatggctcgtcgccgaccgcaccggagtcctccgtcgcggc
acgacccccacccgcgccgcggacgggccggaacgttcgttcggcgtggttttagacaca
gtggacactgcgctggccgcgttgccctcgacgcacacgcccgtggggatcggcctggcc
gttcccggcacggtcgacgaacgtcgcggggtgtgcgtgtactcggagaacctgggctgg
cgggaactgcccgtggtcgaacgggtcttgcggcacaccggtctgcctgtgggcttcggc
cacgacgtgcgctcggcggcgacggcggagtggcggctcggcgcgggccgcggaatcgcc
gaccaggtgtacgtgtcggtgggcacgggactggccgctgcgctgctgctcgacggccgc
ctggtggtctcgggcggctacgccggggagatcggccacggcggcacactcgagggcgaa
ccctgtacctgtggcgggcggggctgcgcggagaccgtcgcctcggccgccgcgatcgcc
cgccgctacacggcgtcgacgggaatccccgtcgacggcgcacgggacgtgctcgcccgc
gcccgggaaggcgacgcggtggcccaccgggtgtgggaggacgccgtcgaggtgctgggt
tccgtcgtggcggacctgatccgcgtgaccggcgtggcccggatcgtcatcggcggcggc
ctggtccacgcgggagaagccctgctcacgccgctacgggaccgagtgcgcgaacggctc
accgtgcaccccaccgcgcacatcctgcccgccgtcctcggcggagcggccggttcgtgg
ggcgccgcgctgctcggctgggaggcggccgacatcgacctcgacccgatcctcaccgcg
tacgcggacgcagtgcgtacccgaagcgaacccggtgcggccgaatga

DBGET integrated database retrieval system