KEGG   Saccharomonospora viridis: Svir_17940Help
Entry
Svir_17940        CDS       T00980                                 

Definition
Zn-dependent alcohol dehydrogenase
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
svi  Saccharomonospora viridis
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:svi00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Svir_17940
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Svir_17940
  Lipid metabolism
   00071 Fatty acid degradation
    Svir_17940
  Amino acid metabolism
   00350 Tyrosine metabolism
    Svir_17940
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Svir_17940
   00626 Naphthalene degradation
    Svir_17940
Enzymes [BR:svi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Svir_17940
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1861485..1862555
Genome map
AA seq 356 aa AA seqDB search
MGETMRALRLTGWQAPVAWQDVPVPEPGPGQVLVEVLATGLCHSDLNVMDARAGWLHYPL
PFTLGHEVAGRVVATGSGVDSHWDGRRVVVHGVWSCRTCRNCLRGRENHCPTLGRTERGL
PRIGCGLGWDGGLAPYLLVPSPDFLVRADGVDPTVLAPLADAGLTAYHAVRQHADLLDGN
SVCVVVGVGGLGHLALQVLRELGCGTVLAADTRAAARDLAARLGADHVVDDVDRLRGTTC
ALGGADVVLDFVVSPDTVATAAELLASGGRLVMVGAGGGRLVTGKDGRLPTGWQVSAPFW
GTRAGLVEVVRLAAAGRLWPETEVHRLEDALDVYARLRRGDVRGRAVVVPRSEAVR
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atgggcgagacgatgcgggcactgcggttgaccggatggcaagccccggtggcctggcag
gatgtccccgtccccgaaccggggccgggtcaggtgctcgtcgaggtgctggcgacaggg
ctgtgccactccgacctcaacgtcatggacgcacgggccgggtggctgcactatcccttg
ccgttcacgttgggacacgaggtcgcaggccgcgtggtcgccaccggcagcggtgtcgac
tcgcattgggacggtcgacgggtcgtggtccacggggtgtggtcgtgtcgcacctgccgc
aactgcctgcgtggtcgggagaatcactgccccaccttggggcgcaccgaacgtgggctc
ccgcggatcggttgcggtctcgggtgggacggtgggctcgcgccgtatctgctcgttccc
tcccccgacttcctggtgcgggcggacggggtggaccccaccgtgctggcaccgttggcg
gacgccgggctgaccgcctaccacgccgtgcggcaacacgctgacctcctcgacgggaac
tcggtgtgcgtggtggtcggcgtcggtggtctcggccacctggcgttgcaggtccttcgt
gagctgggctgcggcacggtgctcgccgccgacacccgtgccgcagcccgtgatctggcg
gcccggctcggcgccgatcacgtcgtcgacgacgtggaccgtctgcgcgggaccacgtgc
gctctcggcggtgcggacgtcgtgttggacttcgtcgtgtccccggacaccgtggcgacc
gctgcagagctgctcgcctccggcggccggttggtgatggtcggagccgggggcggtcgg
ctggtcaccgggaaggacggtcgattgccgaccgggtggcaggtgtcggctccgttctgg
gggacgcgggcggggctggtggaggtggtccggctcgccgcggcgggtcggctgtggccc
gagacggaggtgcaccggctggaggacgcactcgacgtgtacgcccggttgcgccgtggg
gacgtccgtggtcgcgcggtggtggtgccgcggtcggaagcggttcggtga

DBGET integrated database retrieval system