KEGG   Saccharomonospora viridis: Svir_20250Help
Entry
Svir_20250        CDS       T00980                                 

Definition
benzaldehyde dehydrogenase (NAD+) (EC:1.2.1.28)
Orthology
K00141  
benzaldehyde dehydrogenase (NAD) [EC:1.2.1.28]
Organism
svi  Saccharomonospora viridis
Pathway
Xylene degradation
Toluene degradation
Aminobenzoate degradation
Metabolic pathways
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Class
Metabolism; Overview; Degradation of aromatic compounds [PATH:svi01220]
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation [PATH:svi00627]
Metabolism; Xenobiotics biodegradation and metabolism; Toluene degradation [PATH:svi00623]
Metabolism; Xenobiotics biodegradation and metabolism; Xylene degradation [PATH:svi00622]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2160085..2161545)
Genome map
AA seq 486 aa AA seqDB search
MTASTAGPVGDSPTRWSSSAATGGTLTVTAPATGSVLAEVDAASPADVDRAVAKAKQAQR
DWAATTYDQRAAVLRRAARLLEADPDRLRRWLVPESGSAMGKASFEVGLVVSELDECAAL
ASHPYGELLHSTKPRLSLARRVPVGVVGVISPFNFPGILSMRSVAPALAVGNAVVLKPDP
RTPISGGLALAELLAEAGLPDGLLTVLPGGAEVGQALVAHPDVPCISFTGSTPAGRKIAE
AAAPLLKRVHLELGGNNALLVLPDADVEAAASAAAWGSFLHQGQICMTAGRHLVHSSIAD
EFTALLAKKAEAITVGDPTDENNALGPIIDERQREQIHRIVTDTVDAGAKLLAGGKYDGL
FYRPTVLGNVPVDSPAFRQEIFGPVAPVVTYDTVDEAIELINDSEFGLSVGILTSDAFRA
YELADRIESGMVHINDQTVDDEATIPFGGVKASGAGGRFGGARANLESFTEIQWITMQSS
IERYPF
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
gtgacagctagtacagccggtccggtcggtgacagccccactcgctggtcttcctcggcg
gccacgggcggtactttgacggtgacggcgcctgccacgggcagtgtcctcgccgaggtc
gacgcggcttcccccgccgatgtcgaccgtgccgtcgccaaggcgaagcaggcccagcgg
gactgggccgccaccacctacgaccagcgcgccgcggtgctgcggcgggccgctcgactg
ttggaagccgaccccgaccggttgcgccgttggctcgtccccgaatcgggttcggcgatg
ggcaaggcgtcgttcgaggtcggcctggtggtctcggaactcgacgaatgcgcggcgctg
gcctctcatccctacggtgaactgctgcactccaccaaaccgcgcctgtcgctggcacgt
cgcgtaccggtcggcgtggtgggggtgatctcgccgttcaacttccccggaatcctgtcg
atgcggtccgtcgcgcccgcgttggcggtgggcaacgccgtggtgttgaaacccgatccc
cgcacgccgatctcgggtggtctcgcgctcgccgagctgctcgccgaggcggggttgccc
gacgggttgctcaccgtgttgcccggcggcgcggaggtcggacaggcgctggtggcccac
cccgacgtgccgtgcatctcgttcaccggatccaccccggccggacgcaagatcgcggag
gccgccgcgccgctgctcaagcgcgtgcacctggaactcgggggcaacaacgcactactc
gtgctcccggacgccgacgtcgaagccgccgcctcggccgccgcgtggggttcgttcctg
caccagggacagatctgcatgacggcggggcggcacctcgtgcactcgtcgatcgcggac
gagttcacggcgttgctcgcgaagaaggccgaggccatcaccgtcggagacccgacggac
gagaacaacgcactcggcccgatcatcgacgaacggcagcgggagcagatccaccgcatc
gtgaccgacacggtggacgcgggcgcgaaactgctcgccggagggaagtacgacggcctg
ttctaccggccgacggtcctggggaacgtcccggtcgacagcccggcgttccggcaggag
atcttcggtccggtggcccccgtggtcacgtacgacaccgtggacgaggcgatcgagctc
atcaacgacagcgagttcggcctcagcgtcggcatcctgacctccgacgcgttccgggca
tacgagctcgcggaccggatcgagtcgggcatggtccacatcaacgaccagacggtcgac
gacgaggccacgatcccgttcggtggcgtgaaggcctccggggcgggcggccgcttcggt
ggtgcgcgggccaacctggagtcgttcaccgagatccagtggatcacgatgcagtcgtcg
atcgagcgttatccgttctga

DBGET integrated database retrieval system