KEGG   Saccharomonospora viridis: Svir_22620Help
Entry
Svir_22620        CDS       T00980                                 

Definition
(GenBank) acyl-CoA synthetase/AMP-acid ligase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
svi  Saccharomonospora viridis
Pathway
svi00010  Glycolysis / Gluconeogenesis
svi00620  Pyruvate metabolism
svi00640  Propanoate metabolism
svi00680  Methane metabolism
svi01100  Metabolic pathways
svi01110  Biosynthesis of secondary metabolites
svi01120  Microbial metabolism in diverse environments
svi01130  Biosynthesis of antibiotics
svi01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:svi00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Svir_22620
   00620 Pyruvate metabolism
    Svir_22620
   00640 Propanoate metabolism
    Svir_22620
  Energy metabolism
   00680 Methane metabolism
    Svir_22620
Enzymes [BR:svi01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Svir_22620
Lipid biosynthesis proteins [BR:svi01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Svir_22620
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: ACU97270
UniProt: C7MXJ1
Position
complement(2432478..2434262)
Genome map
AA seq 594 aa AA seqDB search
MAVGTGGVSADATSGSTEAYRRFRQARDLLLEHREDYAKADAEFAWPTFAEFNWALDWFD
RIAAEEHNAQRPALWIVEEDGSENRWTFPELSRRSNQVANWLREHGVRRGDRLILMLGNQ
VELWETILACCKLGAVIIPASTLLGAADLRDRVERGRARHVVVRDVDVEKFADVPGEYTR
IAVGERTDGWVRFADAYEAEATFTPDGPTRADDPLLLYFTSGTTAQPKLVQHTHTSYPVG
HLSTMYWIGLEPGDVHLNISSPGWAKHAWSNVFAPWNAEATVFLYNYSRFDPVALMEQLD
RCGITSFCAPPTVWRMLIQADLTTLRTPPRKVVGAGEPLNPEVIEQVRRAWGVTIRDGFG
QTESSVQIANTPGQPVKPGSMGRALPGFTVALLDPITGRPAREGEICLDLSSRPVGLMTG
YEGDDERTEEAFAGGYYHTGDVGAVDDDGYITYVGRMDDVFKASDYRISPFELESVLLEH
EAVAEAAVVPAPDPIRLAVPKAYVVLANGYEPTAATAEDILAFCRRHLAPYKRIRRLQVR
GPTQDHFRQDPQGRTAERGERSGRDAGRGGVPGGGLPVVEVLTTSFEVVLSPQS
NT seq 1785 nt NT seq  +upstreamnt  +downstreamnt
gtggccgtagggactggcggtgtcagcgccgacgccaccagcggttccacggaggcgtac
cgaaggttccggcaagcccgggacctgttgttggagcaccgggaggactacgcgaaggcc
gacgcggagttcgcgtggcccacgttcgcggagttcaactgggcgctcgactggttcgac
cggatcgccgccgaggagcacaacgctcagcgtcccgccttgtggatcgtcgaggaggac
ggttcggagaaccgctggacgtttcccgaactgtcgcggcgctccaatcaggtggcgaac
tggttgcgtgagcacggggtgcgacgcggcgatcggctgatcctgatgctcggcaaccag
gtggagctgtgggagacgatcctcgcctgctgcaagctcggggcggtgatcatcccggcg
tccaccctgctcggggcggcggatctgcgggaccgtgtggaacgcggccgggcgaggcat
gtcgtggtacgtgatgtcgacgtcgagaagttcgccgacgtcccgggcgagtacacgcgc
atcgcggtgggggagcgtacggacggttgggtgaggttcgccgacgcctacgaggccgag
gcgacgttcaccccggacggtccgacgcgggccgacgacccgctgttgctgtacttcacc
tccggcaccacggcccagccgaaactggtgcagcacacccacacgtcgtaccccgtcggc
cacctctcgacgatgtactggatcggcctggaaccgggcgacgtacacctcaacatctcc
tcgcccggttgggccaaacacgcgtggagcaacgtgttcgcgccgtggaacgccgaagcc
acggtgtttttgtacaactactcgcggttcgacccggtcgcgctgatggagcagctcgac
cgttgtgggatcacgagtttctgcgctccgccgacggtgtggcgcatgctcatccaggcg
gacctgaccacgttgcgtaccccgccccgcaaggtcgtcggcgcgggtgaaccgttgaac
cccgaggtcatcgaacaggtgcgccgcgcatggggagtgacgatccgcgacgggttcggt
cagacggagagcagtgtgcagatcgccaacaccccgggacagcccgtcaaacccgggtcc
atggggcgcgctctccccggtttcaccgtcgccctgctcgacccgatcacgggccggccc
gctcgggagggggagatctgtctggatctctcgtcccgtcccgtggggctcatgacgggc
tacgagggtgacgacgagcgtaccgaggaggcgttcgcgggcggctactaccacaccggt
gacgtcggtgccgtcgacgacgacggctacatcacctacgtgggtcggatggacgacgtg
ttcaaggcttccgactaccggatctcgccgttcgaactggagagcgtcctactcgaacac
gaggccgtggccgaggccgccgtcgtgcccgcacccgacccgatccggctcgccgtgccc
aaggcgtacgtggtgctggcgaacgggtacgaacccaccgcggcgacggccgaggacatc
ctcgcgttctgtcggcggcacctcgccccgtacaagcggatccggaggttgcaagttcgc
ggacctacccaagaccatttccggcaagatccgcagggtcgaactgcggaacgcggagaa
cgctcggggcgggacgcgggtcgagggggagttccgggaggaggacttcccgtcgttgaa
gtcctgacgacgtccttcgaagtggtcctttccccacagtcctga

DBGET integrated database retrieval system