KEGG   Saccharomonospora viridis: Svir_22620Help
Entry
Svir_22620        CDS       T00980                                 

Definition
acyl-CoA synthetase/AMP-acid ligase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
svi  Saccharomonospora viridis
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:svi01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:svi00010]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:svi00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:svi00640]
Metabolism; Energy metabolism; Methane metabolism [PATH:svi00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2432478..2434262)
Genome map
AA seq 594 aa AA seqDB search
MAVGTGGVSADATSGSTEAYRRFRQARDLLLEHREDYAKADAEFAWPTFAEFNWALDWFD
RIAAEEHNAQRPALWIVEEDGSENRWTFPELSRRSNQVANWLREHGVRRGDRLILMLGNQ
VELWETILACCKLGAVIIPASTLLGAADLRDRVERGRARHVVVRDVDVEKFADVPGEYTR
IAVGERTDGWVRFADAYEAEATFTPDGPTRADDPLLLYFTSGTTAQPKLVQHTHTSYPVG
HLSTMYWIGLEPGDVHLNISSPGWAKHAWSNVFAPWNAEATVFLYNYSRFDPVALMEQLD
RCGITSFCAPPTVWRMLIQADLTTLRTPPRKVVGAGEPLNPEVIEQVRRAWGVTIRDGFG
QTESSVQIANTPGQPVKPGSMGRALPGFTVALLDPITGRPAREGEICLDLSSRPVGLMTG
YEGDDERTEEAFAGGYYHTGDVGAVDDDGYITYVGRMDDVFKASDYRISPFELESVLLEH
EAVAEAAVVPAPDPIRLAVPKAYVVLANGYEPTAATAEDILAFCRRHLAPYKRIRRLQVR
GPTQDHFRQDPQGRTAERGERSGRDAGRGGVPGGGLPVVEVLTTSFEVVLSPQS
NT seq 1785 nt NT seq  +upstreamnt  +downstreamnt
gtggccgtagggactggcggtgtcagcgccgacgccaccagcggttccacggaggcgtac
cgaaggttccggcaagcccgggacctgttgttggagcaccgggaggactacgcgaaggcc
gacgcggagttcgcgtggcccacgttcgcggagttcaactgggcgctcgactggttcgac
cggatcgccgccgaggagcacaacgctcagcgtcccgccttgtggatcgtcgaggaggac
ggttcggagaaccgctggacgtttcccgaactgtcgcggcgctccaatcaggtggcgaac
tggttgcgtgagcacggggtgcgacgcggcgatcggctgatcctgatgctcggcaaccag
gtggagctgtgggagacgatcctcgcctgctgcaagctcggggcggtgatcatcccggcg
tccaccctgctcggggcggcggatctgcgggaccgtgtggaacgcggccgggcgaggcat
gtcgtggtacgtgatgtcgacgtcgagaagttcgccgacgtcccgggcgagtacacgcgc
atcgcggtgggggagcgtacggacggttgggtgaggttcgccgacgcctacgaggccgag
gcgacgttcaccccggacggtccgacgcgggccgacgacccgctgttgctgtacttcacc
tccggcaccacggcccagccgaaactggtgcagcacacccacacgtcgtaccccgtcggc
cacctctcgacgatgtactggatcggcctggaaccgggcgacgtacacctcaacatctcc
tcgcccggttgggccaaacacgcgtggagcaacgtgttcgcgccgtggaacgccgaagcc
acggtgtttttgtacaactactcgcggttcgacccggtcgcgctgatggagcagctcgac
cgttgtgggatcacgagtttctgcgctccgccgacggtgtggcgcatgctcatccaggcg
gacctgaccacgttgcgtaccccgccccgcaaggtcgtcggcgcgggtgaaccgttgaac
cccgaggtcatcgaacaggtgcgccgcgcatggggagtgacgatccgcgacgggttcggt
cagacggagagcagtgtgcagatcgccaacaccccgggacagcccgtcaaacccgggtcc
atggggcgcgctctccccggtttcaccgtcgccctgctcgacccgatcacgggccggccc
gctcgggagggggagatctgtctggatctctcgtcccgtcccgtggggctcatgacgggc
tacgagggtgacgacgagcgtaccgaggaggcgttcgcgggcggctactaccacaccggt
gacgtcggtgccgtcgacgacgacggctacatcacctacgtgggtcggatggacgacgtg
ttcaaggcttccgactaccggatctcgccgttcgaactggagagcgtcctactcgaacac
gaggccgtggccgaggccgccgtcgtgcccgcacccgacccgatccggctcgccgtgccc
aaggcgtacgtggtgctggcgaacgggtacgaacccaccgcggcgacggccgaggacatc
ctcgcgttctgtcggcggcacctcgccccgtacaagcggatccggaggttgcaagttcgc
ggacctacccaagaccatttccggcaagatccgcagggtcgaactgcggaacgcggagaa
cgctcggggcgggacgcgggtcgagggggagttccgggaggaggacttcccgtcgttgaa
gtcctgacgacgtccttcgaagtggtcctttccccacagtcctga

DBGET integrated database retrieval system