KEGG   Saccharomonospora viridis: Svir_22690Help
Entry
Svir_22690        CDS       T00980                                 

Definition
xylose isomerase
Orthology
K01805  
xylose isomerase [EC:5.3.1.5]
Organism
svi  Saccharomonospora viridis
Pathway
Pentose and glucuronate interconversions
Fructose and mannose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:svi00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Svir_22690
   00051 Fructose and mannose metabolism
    Svir_22690
Enzymes [BR:svi01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.5  xylose isomerase
     Svir_22690
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2440859..2442028)
Genome map
AA seq 389 aa AA seqDB search
MVGKPVAEDKFSFGLWTVGWRAADPFGDATRPELDVVETVHKLAELGAWGVTFHDNDLIP
FGSDEREREKRISRFRTALDETGLVVPMATTNLFTHPVFKDGALTSNDRDIRRFALRKVM
RNMDLAAELGATTYVLWGGREGSETDAAKDVRAAMDRYREGIDTLAQYVVEQGYGLRLAL
EPKPNEPRGDILLPTIGHALAFISTLEHHEMVGLNPEVGHEQMAGLNFVHGIGQALWQGK
LFHIDLNGQHGPRYDQDLVFGHGDVLSAFFLVDLLEHGGYDGPRHFDYKPPRTEDIDGVW
ASAEANMRSYLLLRERAKAFRADPRVQEALERSRVPELAQPTLAEGETVSDLKADRTAFE
EFDVDAAAARGYAYAQLSQLAFEHLLGAA
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
gtggtcggcaaacccgtggcagaggacaagttcagtttcggtctgtggacggtgggctgg
cgggccgccgatccgttcggtgacgcgacgaggcccgagctcgacgtggtcgagacggtg
cacaagctggccgaactgggtgcgtggggagtgaccttccacgacaacgacctcattccc
ttcggcagtgacgagcgtgagcgcgagaagcggatcagccggttccggacggcgctcgac
gagaccggactcgtggtgccgatggccaccaccaacctgttcacccaccccgtgttcaag
gacggtgcgctcaccagcaacgaccgtgacatccgtcggttcgcgctgcgcaaggtgatg
cgcaacatggatcttgcggccgaactcggcgcgacgacgtacgtgttgtggggcggtcgt
gagggcagcgagacggacgcggccaaggacgtgcgtgccgcgatggaccgctatcgcgaa
gggatagacacgctcgcgcagtacgtcgtggagcaaggctacgggctgaggttggcgctg
gaacccaagccgaacgaaccgcgcggggacatcctgctgcccaccatcgggcatgcgctg
gcgttcatctccaccttggaacaccacgagatggtggggctcaaccccgaggtcggccac
gagcagatggccgggctgaacttcgtgcacggcatcggccaggcgttgtggcagggcaag
ttgttccacattgacctcaacggccaacacggacctcggtacgaccaggacctcgtgttc
ggacacggcgacgtgctgtcggcgttctttttggtggacctgctcgaacacggcggatac
gacggcccccgacacttcgactacaagccgccgcgtaccgaggacatcgacggtgtgtgg
gccagcgcggaggccaacatgcggtcgtatctgttgttgcgggagcgggcgaaggccttc
cgtgccgacccgcgggtgcaggaggcgctggaacgttcccgggtgccggaactggcgcag
ccgacgttggccgagggggagacggtgtccgatctcaaggccgatcgaaccgcgttcgag
gagttcgacgtcgacgccgcggccgcccgcggctacgcctacgcccagttgtcacaactg
gccttcgaacatctcctgggcgcggcctaa

DBGET integrated database retrieval system