KEGG   Saccharomonospora viridis: Svir_24080Help
Entry
Svir_24080        CDS       T00980                                 

Definition
(GenBank) protoporphyrinogen oxidase
  KO
K00231  protoporphyrinogen/coproporphyrinogen III oxidase [EC:1.3.3.4 1.3.3.15]
Organism
svi  Saccharomonospora viridis
Pathway
svi00860  Porphyrin and chlorophyll metabolism
svi01100  Metabolic pathways
svi01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:svi00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Svir_24080
Enzymes [BR:svi01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     Svir_24080
    1.3.3.15  coproporphyrinogen III oxidase (coproporphyrin-forming)
     Svir_24080
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amino_oxidase NAD_binding_8 DAO AlaDh_PNT_C Pyr_redox_2 NAD_binding_9 FAD_binding_2 Thi4 HI0933_like Glu_dehyd_C Trp_halogenase GIDA F420_oxidored MCRA
Motif
Other DBs
NCBI-ProteinID: ACU97405
UniProt: C7MYI6
Position
complement(2597022..2598470)
Genome map
AA seq 482 aa AA seqDB search
MKGNAEDGRRRGARPSRVVVVGAGIAGLAAAWRLRAELGAEAQITVCDAASVPGGKVRTV
EVAGRRFDVGAEAVLARRPEAVTLIREVGLGDDLVHPTSASSAIRALGRTVPMPKGTMMG
IPASAEAVADVLSQDGVEAVAAEAGGPPLSLPDHDVSLGGLLRSRFGDEVVDRLVDPLLG
GVYAGGADGLGLRATLPAVAAAVDAGATSLTEAVARTLPERPSSAPVFATLRGGLGDLVD
RLVESGAVELRLGQPVRELVRRPSGGWRLRTGAAALSHAPADAELDADAVVLAVPPPAAS
RLLATVAPDAASAYAEMELASMAVVALALPPGTELPPSSGILIGERERRADGTRFTAKAF
TFSARKWEHHNRPGEPVLIRGSVGRFGEVSTLQASDDELVERVRRDLAELTGITASPVDT
YVMRWGGGLPQYSVGHLDRVARIERAVAGLDGLAVAGAALHGVGLPACVATGDAAARRVV
GQ
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
gtgaagggaaacgccgaagacggccgccggcgcggagcccgaccgtcccgggtggtggtg
gtcggggcggggatcgccggccttgccgccgcgtggcggcttcgcgccgaactgggagcg
gaagcgcagatcaccgtgtgcgacgcggcgtccgtacccggggggaaggtgcggaccgtc
gaggtggcggggcgacggttcgacgtgggcgccgaagccgtgctcgccagacggccggag
gcggtgacactgatccgtgaggtcgggctcggcgacgacctcgtacacccgacgtccgcc
tcatccgccatccgtgccctggggcgtacggtgccgatgccgaagggcacgatgatgggc
atcccggcttcggccgaggcggtggcggacgtgctgtcccaggacggggtcgaggcggtc
gcggcggaggccggaggaccgccgctgtcgttgccggaccacgacgtgtccctgggcggc
ctcctgcgtagccggttcggcgatgaagtggtggaccggctcgtcgacccgctgctgggc
ggggtctacgccgggggagcggacggactggggctgcgggccaccctgcccgctgtggcc
gcggccgtggacgcgggtgcgacgtcgctgaccgaggcggtcgccaggacgctgccggaa
cggcccagttcggcgcccgtgttcgcgacgctgcgcggcggcctgggtgatctcgtggat
cgactcgtcgagagcggcgccgtcgaactccgcctcggacagcccgtacgtgaactcgtc
cggcgcccttccggggggtggcggctgcggaccggggcagcggcgctctcccatgccccc
gccgacgccgagttggacgccgacgccgtggtactcgcggtacctccgcccgcggcgagc
aggctgctcgccacagtggccccggacgccgcgtccgcgtacgccgagatggaactggcg
tcgatggcggtcgtcgccctggcgctgcctcccggcacggagttgccgccatcgtcgggg
atcctgatcggagagcgggaacggcgtgccgacggtacgcggttcacggcgaaagccttc
accttctcggcccgcaaatgggagcaccacaaccggccgggtgagccggtgctgatccga
ggatcggtcggccggttcggcgaggtgagcacgcttcaggcctccgacgacgagctggtc
gaacgcgtgcgccgtgatctcgccgaactgaccggcatcaccgcctcgccggtggacacc
tacgtcatgcgctggggtgggggcttgccgcagtacagcgtggggcatctcgatcgtgtc
gcgcgtatcgaacgggccgtcgccgggctcgacgggctcgcggtcgccggtgcggctctg
catggtgtgggactgcccgcatgtgtggccaccggggacgcggcagcccgccgtgtagtg
ggacaatga

DBGET integrated database retrieval system