KEGG   Saccharomonospora viridis: Svir_24080Help
Entry
Svir_24080        CDS       T00980                                 

Definition
protoporphyrinogen oxidase
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
svi  Saccharomonospora viridis
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Heme biosynthesis, glutamate => protoheme/siroheme
Brite
KEGG Orthology (KO) [BR:svi00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Svir_24080
Enzymes [BR:svi01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     Svir_24080
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2597022..2598470)
Genome map
AA seq 482 aa AA seqDB search
MKGNAEDGRRRGARPSRVVVVGAGIAGLAAAWRLRAELGAEAQITVCDAASVPGGKVRTV
EVAGRRFDVGAEAVLARRPEAVTLIREVGLGDDLVHPTSASSAIRALGRTVPMPKGTMMG
IPASAEAVADVLSQDGVEAVAAEAGGPPLSLPDHDVSLGGLLRSRFGDEVVDRLVDPLLG
GVYAGGADGLGLRATLPAVAAAVDAGATSLTEAVARTLPERPSSAPVFATLRGGLGDLVD
RLVESGAVELRLGQPVRELVRRPSGGWRLRTGAAALSHAPADAELDADAVVLAVPPPAAS
RLLATVAPDAASAYAEMELASMAVVALALPPGTELPPSSGILIGERERRADGTRFTAKAF
TFSARKWEHHNRPGEPVLIRGSVGRFGEVSTLQASDDELVERVRRDLAELTGITASPVDT
YVMRWGGGLPQYSVGHLDRVARIERAVAGLDGLAVAGAALHGVGLPACVATGDAAARRVV
GQ
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
gtgaagggaaacgccgaagacggccgccggcgcggagcccgaccgtcccgggtggtggtg
gtcggggcggggatcgccggccttgccgccgcgtggcggcttcgcgccgaactgggagcg
gaagcgcagatcaccgtgtgcgacgcggcgtccgtacccggggggaaggtgcggaccgtc
gaggtggcggggcgacggttcgacgtgggcgccgaagccgtgctcgccagacggccggag
gcggtgacactgatccgtgaggtcgggctcggcgacgacctcgtacacccgacgtccgcc
tcatccgccatccgtgccctggggcgtacggtgccgatgccgaagggcacgatgatgggc
atcccggcttcggccgaggcggtggcggacgtgctgtcccaggacggggtcgaggcggtc
gcggcggaggccggaggaccgccgctgtcgttgccggaccacgacgtgtccctgggcggc
ctcctgcgtagccggttcggcgatgaagtggtggaccggctcgtcgacccgctgctgggc
ggggtctacgccgggggagcggacggactggggctgcgggccaccctgcccgctgtggcc
gcggccgtggacgcgggtgcgacgtcgctgaccgaggcggtcgccaggacgctgccggaa
cggcccagttcggcgcccgtgttcgcgacgctgcgcggcggcctgggtgatctcgtggat
cgactcgtcgagagcggcgccgtcgaactccgcctcggacagcccgtacgtgaactcgtc
cggcgcccttccggggggtggcggctgcggaccggggcagcggcgctctcccatgccccc
gccgacgccgagttggacgccgacgccgtggtactcgcggtacctccgcccgcggcgagc
aggctgctcgccacagtggccccggacgccgcgtccgcgtacgccgagatggaactggcg
tcgatggcggtcgtcgccctggcgctgcctcccggcacggagttgccgccatcgtcgggg
atcctgatcggagagcgggaacggcgtgccgacggtacgcggttcacggcgaaagccttc
accttctcggcccgcaaatgggagcaccacaaccggccgggtgagccggtgctgatccga
ggatcggtcggccggttcggcgaggtgagcacgcttcaggcctccgacgacgagctggtc
gaacgcgtgcgccgtgatctcgccgaactgaccggcatcaccgcctcgccggtggacacc
tacgtcatgcgctggggtgggggcttgccgcagtacagcgtggggcatctcgatcgtgtc
gcgcgtatcgaacgggccgtcgccgggctcgacgggctcgcggtcgccggtgcggctctg
catggtgtgggactgcccgcatgtgtggccaccggggacgcggcagcccgccgtgtagtg
ggacaatga

  All links  
No link information was found.   
DBGET integrated database retrieval system