KEGG   Saccharomonospora viridis: Svir_24790Help
Entry
Svir_24790        CDS       T00980                                 

Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
svi  Saccharomonospora viridis
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:svi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Svir_24790
   01230 Biosynthesis of amino acids
    Svir_24790
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Svir_24790
   00030 Pentose phosphate pathway
    Svir_24790
   00051 Fructose and mannose metabolism
    Svir_24790
   00052 Galactose metabolism
    Svir_24790
  Energy metabolism
   00680 Methane metabolism
    Svir_24790
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    Svir_24790
Enzymes [BR:svi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Svir_24790
Protein phosphatases and associated proteins [BR:svi01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Svir_24790
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2672729..2673757)
Genome map
AA seq 342 aa AA seqDB search
MMRVGVLTGGGDCPGLNAVIRAVVRKGVEMHGWEVYGFRDGWRGPLTGQGMWLSPDDVEG
ILTRGGTILGSSRTNPYSDDGGADAIKRVLSDKGLDALIAIGGEDTLGVAKRLNDDGVKV
VGVPKTIDNDLGATDYTFGFDTAVHIATEAIDRLHTTAESHHRALVVEVMGRHAGWIALH
SGLAGGASVILVPERPFSVDKVVGWVERRFEREYAPIIVVAEGALPEGGAAVLQSGEKDA
FGHVRLGGVGIWLADEIASRTGKESRAVVLGHTQRGGTPTAYDRVLATRFGLHAVDAVAD
GDFGVMVALRGTDIVRVKLAEATAELKTVPLDRYKEAEVFFG
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgatgcgagtcggtgtgctgaccggcggtggcgattgcccgggcttgaacgcggtgatc
cgcgcggtcgtccgcaagggcgttgaaatgcacggctgggaggtctacggctttcgcgac
ggctggcgcgggccactgaccgggcagggcatgtggttgtcccccgatgacgtcgaggga
atcctcacccgcggtggcacgatcctcggctcctctcgcacgaacccgtactccgacgac
ggtggtgccgacgccatcaagcgtgtgctgtcggacaagggcctcgacgccctcatcgcc
atcggcggggaggacacgctcggtgtggccaagcggctgaacgacgacggggtgaaagtg
gtcggcgtgcccaagacgatcgacaacgatctcggcgccaccgactacaccttcggcttc
gacaccgcggtccacatcgccacggaggccatcgaccgactccacaccaccgccgagtcc
caccaccgggcgctcgtcgtcgaagtgatgggcaggcacgccggctggatcgcattgcat
tcggggctcgcgggcggggccagtgtcatcctcgttcccgagcggccgttctcggtggac
aaggtcgtcggctgggtcgagcgccggttcgagcgcgagtacgccccgatcatcgtcgtg
gccgagggcgcgctaccggaaggtggggccgcggtgctgcagagcggggagaaggacgcg
ttcgggcacgtccggttgggtggcgtgggcatctggctggccgatgagatcgcctcgcgc
accggtaaggagtcccgggcggtggtactgggacacacacagcgtggtggtacgccgacc
gcttacgaccgggtgctggccacgcgtttcggtttgcacgccgtggacgccgtggccgac
ggcgacttcggtgtgatggtggcgttgcggggcacggacatcgtgcgggtcaaactcgcc
gaagccacggcggaactgaagaccgtgccgctggaccgctacaaggaggcggaggtcttc
ttcggctga

DBGET integrated database retrieval system