KEGG   Saccharomonospora viridis: Svir_24830Help
Entry
Svir_24830        CDS       T00980                                 

Definition
esterase/lipase
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
svi  Saccharomonospora viridis
Brite
Enzymes [BR:svi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     Svir_24830
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2676721..2677482
Genome map
AA seq 253 aa AA seqDB search
MPVFAGAEPFVHDGSPEVGVLLCHGFTSTPATMRPWGEYLAEAGFTVRCPRLPGHGTSWQ
ECNRTRWPDWYGCLRDEFAGLARRCESVFVFGLSMGGTLALRLAQDLGDAVRGLVLVNPS
VLTRRLDAKLATLLAPVLPSAKGLAGDIAKPGVVELAYDRTPVRALASLTRLWTLVRRDL
PRVTQPLLLVRSAVDHVVEGVNATVVADNVRSEDLREVVLHHSYHVATLDNDAPLLFRRS
VEFVDSVRQVGAR
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgcctgtgttcgccggcgctgaacccttcgtccacgacggttctcccgaggtgggagtg
ctcctgtgccacggattcaccagcacaccggcgaccatgcggccgtggggcgaatacctg
gccgaggccggtttcaccgtgcgctgcccccgcttgccgggacacggcaccagctggcag
gagtgcaaccgaacccggtggccggactggtacggctgcctgcgcgacgaattcgccgga
ctcgcccgccggtgcgagtcggtgttcgtgttcggcctgtcgatggggggcaccctcgcc
ctgcggctggcccaggacctcggtgacgccgtgcgcggcctggtactggtgaacccgtcg
gtgctcacccgcaggctcgacgccaaactggccacgctgttggcgccggtactgccgtcg
gcgaaggggctggcgggtgacatcgccaaacccggggtcgtggaactcgcctacgaccgc
accccggtgcgtgcgctggcgagcctgacccgactctggacgctggtccgtcgcgaccta
ccccgggtgacccaaccgctgttgctcgtccgatcagcggtcgatcacgtcgtggaaggt
gtcaacgccaccgtggtggccgacaatgtgcgtagtgaggacctgcgcgaggtagtgctt
caccacagctaccacgtggccacgctcgacaacgacgcaccgttgctgttccggcgcagt
gtggagttcgtcgactccgtcagacaggttggtgcccgatga

DBGET integrated database retrieval system