KEGG   Saccharomonospora viridis: Svir_24860Help
Entry
Svir_24860        CDS       T00980                                 

Definition
glucokinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
svi  Saccharomonospora viridis
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:svi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Svir_24860
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Svir_24860
   00052 Galactose metabolism
    Svir_24860
   00500 Starch and sucrose metabolism
    Svir_24860
   00520 Amino sugar and nucleotide sugar metabolism
    Svir_24860
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Svir_24860
   00524 Butirosin and neomycin biosynthesis
    Svir_24860
Enzymes [BR:svi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Svir_24860
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2678987..2679928)
Genome map
AA seq 313 aa AA seqDB search
MPAIGIDVGGTSVRAGVVDEQGAVLDSTCVATPGSEDALEEAITAVVDELRARHTVDAVG
LAVAGFVRPDRQSVMFAPHLPWRGAPVVERMSKRLGVPVTLEHDANAAAVGEHRFGAARG
ADVALLLALGTGIGAGLLLGGEIFRGAHGVAPELGHLRVVPDGRPCPCGRHGCWERYCSG
TALAATAVELLARQPARPSVLRRDVVDPAAMTGLRVARAAREGDPVAREAMAELARWLGE
GLALIADVYDPEVVVLAGGVAASAPLFADEAREHYARVVTGAGHRPLARIRTSQLGDATA
IVGAATLALERVA
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atgccggcgatcgggattgacgtcgggggcaccagtgtgcgtgcgggtgtcgtcgacgag
cagggcgctgtgctcgactccacgtgcgtcgccacccccggatccgaggacgccctggaa
gaggccatcaccgcggtcgtggacgagttgcgagcgcgacacacggtcgacgccgtggga
ctggcggtggcggggttcgtgagaccggatcgtcaatcggtgatgttcgcaccgcatttg
ccgtggcggggggcaccggtggtcgagaggatgtcgaagcgcctcggcgtgccggtgacc
ctggaacacgacgccaacgccgctgccgtcggtgagcaccgcttcggggcggcacggggc
gcggacgtggcgttgttgttggccctcggtaccgggatcggtgccggactgcttctcggt
ggtgagatcttccgcggtgcccatggggtggcacccgaactagggcatcttcgagtggta
ccggatgggcgtccgtgcccgtgcggccggcacggttgctgggagcgctactgcagcggt
accgccctcgccgccacggccgtcgagctcctcgcccgccagcccgcgcggccgtcggtg
ctcaggcgtgacgtcgtcgatcccgcggcgatgaccggattgcgggtggcccgtgccgcc
cgggaaggggatccggtcgcccgggaagcgatggccgaactcgcgcggtggctcggggag
ggactggcgctcatcgctgacgtctacgaccccgaggtagtcgtgctcgcggggggtgta
gcggcgtcggcgccgttgttcgcggacgaggcacgggagcattacgccagggtggtcacc
ggggcaggacaccggccgctggcccgtattcgcacgtcacagctcggtgacgcgacggcg
atcgtcggtgccgcgaccttggccctcgagcgtgtggcttga

DBGET integrated database retrieval system