KEGG   Saccharomonospora viridis: Svir_28090Help
Entry
Svir_28090        CDS       T00980                                 

Definition
tryptophan synthase, alpha chain
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
svi  Saccharomonospora viridis
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:svi00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Svir_28090
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Svir_28090
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Svir_28090
Enzymes [BR:svi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Svir_28090
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3048266..3049051)
Genome map
AA seq 261 aa AA seqDB search
MSRLAELFETTKAEQRAALVAYLPAGYPTVDGSKELMAAAIDAGADLIEVGVPYSDPVMD
GPTIQSAADTALRNGFRLKHLFEVVESISAKGGRVVVMTYYNPVHRYGVDAFARDLASAG
GLGLITPDLTPDEASEWLTASTEHGLDRIFLVAPSSSDDRIALTTKATTGFVYATAVMGV
TGAREKVGEHAAELVRRTRQHTDLPVGVGLGVRSGDQAAEVAGFADAVIVGSALVAKAAE
GAGPLAEITAELADGVRRPAR
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
gtgagcaggctcgccgagctgttcgagacgacgaaagcggagcagcgggcggcgctggtg
gcctatctgccggccggttacccgaccgtggacggctcgaaggagctgatggccgccgcg
atcgacgcgggcgccgacctcatcgaggtgggggttccgtactcggacccggtgatggac
gggcccaccatccagtccgcggccgacacggcgctgcgcaacggcttccgactcaagcac
ctgttcgaggtcgtggagtcgatctccgcgaagggtggccgggtcgtcgtgatgacgtac
tacaacccggtgcaccgctacggtgtcgacgcgttcgcccgggatttggcctcggcgggc
ggactcgggctgatcacgccggacctcaccccggacgaggcgtcggagtggttgaccgcc
tccaccgaacacggcctcgaccggatcttcctggtggcgccgtcgtcgtccgacgaccgc
atcgcgttgaccacgaaggccaccacgggattcgtctacgcgacggcggtcatgggcgtc
acgggggcgcgggagaaggtgggtgagcacgcggccgaactggtgcggcgcacacggcag
cacacggacctgccggtgggggtcggtctgggtgtgcgttcgggtgaccaggccgccgag
gtggccgggttcgccgacgcggtgatcgtgggctcggccctggtggcgaaggccgcggaa
ggtgccggaccactcgccgagatcacggcggaactggccgatggggtccgtcgacctgcg
cggtga

DBGET integrated database retrieval system