KEGG   Saccharomonospora viridis: Svir_28090Help
Entry
Svir_28090        CDS       T00980                                 

Definition
(GenBank) tryptophan synthase, alpha chain
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
svi  Saccharomonospora viridis
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:svi00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Svir_28090
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Svir_28090
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Svir_28090
Enzymes [BR:svi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Svir_28090
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(3048266..3049051)
Genome map
AA seq 261 aa AA seqDB search
MSRLAELFETTKAEQRAALVAYLPAGYPTVDGSKELMAAAIDAGADLIEVGVPYSDPVMD
GPTIQSAADTALRNGFRLKHLFEVVESISAKGGRVVVMTYYNPVHRYGVDAFARDLASAG
GLGLITPDLTPDEASEWLTASTEHGLDRIFLVAPSSSDDRIALTTKATTGFVYATAVMGV
TGAREKVGEHAAELVRRTRQHTDLPVGVGLGVRSGDQAAEVAGFADAVIVGSALVAKAAE
GAGPLAEITAELADGVRRPAR
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
gtgagcaggctcgccgagctgttcgagacgacgaaagcggagcagcgggcggcgctggtg
gcctatctgccggccggttacccgaccgtggacggctcgaaggagctgatggccgccgcg
atcgacgcgggcgccgacctcatcgaggtgggggttccgtactcggacccggtgatggac
gggcccaccatccagtccgcggccgacacggcgctgcgcaacggcttccgactcaagcac
ctgttcgaggtcgtggagtcgatctccgcgaagggtggccgggtcgtcgtgatgacgtac
tacaacccggtgcaccgctacggtgtcgacgcgttcgcccgggatttggcctcggcgggc
ggactcgggctgatcacgccggacctcaccccggacgaggcgtcggagtggttgaccgcc
tccaccgaacacggcctcgaccggatcttcctggtggcgccgtcgtcgtccgacgaccgc
atcgcgttgaccacgaaggccaccacgggattcgtctacgcgacggcggtcatgggcgtc
acgggggcgcgggagaaggtgggtgagcacgcggccgaactggtgcggcgcacacggcag
cacacggacctgccggtgggggtcggtctgggtgtgcgttcgggtgaccaggccgccgag
gtggccgggttcgccgacgcggtgatcgtgggctcggccctggtggcgaaggccgcggaa
ggtgccggaccactcgccgagatcacggcggaactggccgatggggtccgtcgacctgcg
cggtga

DBGET integrated database retrieval system