KEGG   Saccharomonospora viridis: Svir_28100Help
Entry
Svir_28100        CDS       T00980                                 

Definition
(GenBank) tryptophan synthase, beta chain (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
svi  Saccharomonospora viridis
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:svi00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Svir_28100
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Svir_28100
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Svir_28100
Enzymes [BR:svi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Svir_28100
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(3049048..3050268)
Genome map
AA seq 406 aa AA seqDB search
MSVEQQRTKHDPDERGRFGPYGGRYLPEALMGAVDELAAEYDKARSDPEFARELDRLLTG
YAGRPSLLTEAPRFAEHAGGARIFLKREDLNHTGSHKINNVLGQALLTKRMGKTRVIAET
GAGQHGVATATACALLDLDCVVYMGEVDTQRQALNVARMRLLGAEVVPVRTGSRTLKDAI
NEALRDWVTNVDTTHYLLGSVTGPHPFPLMVRNFHKVIGEEARRQILELTGRLPDAVAAC
VGGGSNAIGMFHGFIDDPDVRLVGFEPGGKGLDSGEHGATLTQGTPGTLHGALSYLLQDA
DGQTIEAYSISAGLDYPGVGPEHSWLKDSGRAEYRPVTDAEAMEAFRLLSRTEGIIPAIE
SAHALAGALQLGRELGPDAHIVVSLSGRGDKDVDAAARYFKLVEDV
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
atgagtgttgagcagcaacgcaccaagcacgaccccgacgagcgtgggcgtttcggcccg
tacgggggtcgttatctgcccgaggccctgatgggcgcggtggacgaactcgcggccgag
tacgacaaggcgaggtcggacccggagttcgctcgggaactcgatcggctgcttaccggg
tatgcgggtaggccgtcgttactcaccgaggctccccggttcgccgagcacgcgggtggc
gcgcgcatcttcctcaagcgcgaggacctcaaccacaccgggtcccacaagatcaacaac
gtgctgggtcaggccctgctcaccaagcgcatgggcaagacccgcgtgatcgccgagacg
ggtgccgggcagcacggggtggcgaccgccacggcgtgcgcgctgctcgacctcgactgt
gtggtctacatgggtgaggtcgacacgcagcgacaggcgctcaacgtcgcgcggatgcgg
ttgctcggtgccgaggtggtgccggtacggaccgggtcgcgcacgttgaaggacgccatc
aacgaggcgctgcgcgactgggtgaccaatgtggacaccacgcattacctgctgggctcg
gtgaccggtccgcatccgttcccgctcatggtgcgcaacttccacaaggtcatcggtgag
gaggcgcgccgccagatcctggaactgaccggccggttgcccgacgccgtcgccgcgtgt
gtcggcgggggttccaacgccatcggcatgttccacggtttcatcgacgacccggacgta
cgtctggtgggcttcgaaccgggcggtaaggggctcgactccggtgagcacggcgccacg
ctcacgcaggggacaccggggacgctgcacggcgcgctgtcgtacctgttgcaggacgcc
gacggccagaccatcgaggcgtactcgatctcggcgggcctggactacccgggcgtcggt
cctgagcactcgtggttgaaggacagcggccgcgccgagtaccggcccgtcaccgacgcc
gaggcgatggaagcgttccgactgctgtcccggaccgagggcatcatccccgcgatcgag
tcggcgcacgcgctcgcgggtgccctccagctcggtcgggaactcggccccgatgcgcac
atcgtggtcagcctgtcgggtcggggggacaaggacgtggacgccgccgcccgatacttc
aagctcgtggaggacgtgtga

DBGET integrated database retrieval system