KEGG   Saccharomonospora viridis: Svir_28110Help
Entry
Svir_28110        CDS       T00980                                 

Definition
(GenBank) indole-3-glycerol phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
svi  Saccharomonospora viridis
Pathway
svi00400  Phenylalanine, tyrosine and tryptophan biosynthesis
svi01100  Metabolic pathways
svi01110  Biosynthesis of secondary metabolites
svi01130  Biosynthesis of antibiotics
svi01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:svi00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Svir_28110
Enzymes [BR:svi01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     Svir_28110
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS FMN_dh OMPdecase QRPTase_C
Motif
Other DBs
NCBI-ProteinID: ACU97792
UniProt: C7MVG3
Position
complement(3050276..3051085)
Genome map
AA seq 269 aa AA seqDB search
MSVLEDIIADVRADLAKREAALPFDELKRRAAAAPEPRDAMAALRESGIAVIAEVKRRSP
SKGLLSAIPDPAALAKDYEDAGARVISVLTESRRFGGSLADLDAVRAAVDVPVLRKDFIV
SPYQVHEARLHGADMVLLIVAALEQNALVSLLDRVESLGMTALVEVHNAEEADRALEAGA
SVIGINARNLHTLEVDRDVFSRLAPGLPMDVYKVAESGVRGPGDLMAYAGHGADAVLVGE
GLVSSDDPKGALVKLVTAGSHPACPRPSR
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgttctggaagacatcatcgctgacgttcgtgccgatctcgccaagcgcgaggcg
gcattgccgttcgacgagctcaagcgtcgtgccgcagcggcgcccgaacccagggacgcc
atggcggcgttgcgggaatccggtatcgccgtcatcgccgaggtgaagcgccgcagccct
tccaaggggctgttgtcggcgattcccgatccggcggcgctggcgaaggactacgaggac
gccggtgcgcgggtgatcagcgtgctcaccgaaagtcgtcgtttcggtgggtcgctggcc
gatttggacgccgtgcgtgcggcggtggacgtaccggtgctgcgtaaggacttcatcgtc
agtccgtaccaggtgcacgaggcgcggctgcacggcgccgacatggtgctgctcatcgtg
gcggccctggagcagaacgcgctggtgtcgttgctcgaccgtgtcgagtcgctcggcatg
accgcgttggtggaggtgcacaacgccgaggaggccgaccgcgcgttggaggcgggcgcg
tccgtcatcggcatcaacgcgcggaacctgcacacgctcgaagtggacagggacgtgttc
tcccggctcgcgcccggacttcccatggacgtctacaaagtggccgagtccggggtgcgt
ggtcccggggacctgatggcgtatgcggggcacggcgccgatgcggtactggtcggtgag
gggctcgtctcctccgacgaccccaagggagccctggtcaaacttgtcacggcgggatcg
caccccgcgtgcccgaggccgagtcggtga

DBGET integrated database retrieval system