KEGG   Saccharomonospora viridis: Svir_28290Help
Entry
Svir_28290        CDS       T00980                                 

Definition
hypothetical protein
Orthology
K16149  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
svi  Saccharomonospora viridis
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:svi00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Svir_28290
Enzymes [BR:svi01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     Svir_28290
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3069177..3070694
Genome map
AA seq 505 aa AA seqDB search
MTETEGTFCLVLHSHLPWLPHHGNWPVGEEWLYQAWAHSYVPLVDLLHRFADEGRRDVLT
LGVTPVLAAQLDDPYALRSFSEWLGHWTLRAQHAASLWRGHDLLSDLASAEYRAAHRVLA
EAESRWRHGFSPLLRSLVDSQVIELLGGPATHPFQPLLDQRVRAFALRTGLADTTLRIGH
RPDGIWAPECGYAPGMEDDYAAAGVHRFLVDGPSLRGDTAAARTVGSTDVVCFGRDLEVT
YRVWSPKAGYPGHSAYRDFHTWAHEVGIKPSRVTGKHIAPEDKAPYDPALAADALRLHVK
DFVETVVQRLRQLRERHGRPSLVVAAYDTELFGHWWYEGPQWLEAVLRALPEAGVRVTTL
RGALEAGHLGGPVELPASSWGSGKDWRVWDGEQVADMVEANAALQRRLLALPVNDAVRDP
VADQAVTEALLALSSDWAFMVTKDSAADYARRRAREHTERFDRLAEALRAGHPDARTLAE
RYRAASLPFGHLDARELFRTATPRR
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaaaccgaaggcaccttctgcctggtactgcacagccacctaccgtggctgccc
caccatggaaactggcccgtcggcgaggaatggctctaccaggcgtgggcgcactcctac
gtacccctggtggacctgctgcaccggttcgccgacgaaggacgtcgcgacgtcctcacc
ctgggcgtcaccccggtgctggcggcacaactcgacgacccgtacgcactgcggtcgttc
tccgaatggctcggccactggaccctgcgggcacagcacgcggcctccctgtggcgtgga
cacgacctgctctccgacctggcctcagccgagtaccgagccgcacaccgtgtactcgcc
gaggcggaatcccgatggcgacacggattctccccgctgcttcggtccttggtggactca
caggtgatcgaactgctcggtggtccggccactcacccgttccagccactactcgaccag
cgggtgcgggcgttcgcgctgcgcaccgggctggcagacacgacgttgcggatcggacac
cgccccgacggcatctgggcccccgaatgcggctacgcaccgggcatggaggacgactac
gccgcggccggggtgcaccgattcctcgtcgacggtccgtccttgcgtggtgacacggcc
gctgcccgcaccgtgggctcgaccgacgtcgtgtgcttcggccgcgatctggaagtgacc
taccgggtgtggtcccccaaggccggctacccgggccacagtgcctatcgcgacttccac
acctgggcccacgaagtgggcatcaagccctcgcgcgtcaccggtaagcacatcgccccc
gaggacaaggccccgtacgatccggcgctcgcggccgacgcactacggctgcacgtgaag
gatttcgtcgaaacggtggtgcagcggctacgtcagctacgggaacgacacggtcgcccc
tccctggtggtggccgcctacgacaccgaactcttcggccactggtggtacgaaggccca
cagtggttggaggccgtgctgcgggcgctgcccgaggcgggcgtgcgggtgacgacgttg
cggggcgcgttggaagccgggcatctcggcggtccggtggaactgcccgcctcctcgtgg
ggttcgggcaaggactggcgggtgtgggacggcgaacaggtcgccgacatggtggaggcc
aacgccgcgctccagcgccgactgctggcgttgcccgtgaacgacgcggtccgtgacccc
gtggccgaccaggccgtcaccgaggcgctgctggccctgtcgagcgactgggcgttcatg
gtgacgaaggactcggccgccgactacgcccgcagacgggcacgcgagcacaccgaacgt
ttcgaccgactcgccgaggcgctgcgcgccgggcaccccgacgcacgcaccctcgccgag
cgctaccgcgccgcctccctgcccttcgggcatctggacgcgcgcgagctgttcaggacc
gcgaccccgcggcgatga

DBGET integrated database retrieval system