KEGG   Saccharomonospora viridis: Svir_28350Help
Entry
Svir_28350        CDS       T00980                                 

Definition
(RefSeq) malate synthase A
  KO
K01638  
malate synthase [EC:2.3.3.9]
Organism
svi  Saccharomonospora viridis
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:svi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Svir_28350
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Svir_28350
   00630 Glyoxylate and dicarboxylate metabolism
    Svir_28350
Enzymes [BR:svi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     Svir_28350
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3075886..3077490)
Genome map
AA seq 534 aa AA seqDB search
MADTVNGRLQVAGPMRERYDEILTPAALEFVAKLDNTFAGRRRELLDERRRRRERLASGE
ETLGFLPQTQRIRNDETWQVAPPAPGLEDRRVEITGPPDRKMTVNALNSGAKVWLADFED
ATSPTWHNIVSGQLNLYDAIRRNIDFTDRGKRYVIGDEPATIVARPRGWHLVEKHIRIDG
RPVSASLVDFGLYFFHNARQLLARGSGPYFYLPKLESHLEARLWNDVFLLAQEELGIPRG
SIRATVLIETITAAFEMDEILYELREHAAGLNAGRWDYIFSIIKTFASHGADFVLPDRAQ
VTMTVPFMRAYTELLVRTCHKRGAHAIGGMAAFIPSRDPEVNATALERVRQDKEREAGDG
FDGSWVAHPGLVPVCREVFDEFLGGWPNQLGRLREDVAVTAHDLLDVVSAGGEVTEQGVR
SNINVALRYIDAWLRGTGAAAIFNLMEDAATAEIARCQVWQWVRNGTKLADGTAVTRERV
TEWLDIELAAVYADLGADNRLSEAREIFVETALGEKLPSFFTTGAYARYLTTPS
NT seq 1605 nt NT seq  +upstreamnt  +downstreamnt
atggctgacacggtgaacggccggctgcaggtcgccggtcccatgcgcgagcgttacgac
gagatcctcactccggccgcgctggagttcgtcgcgaaactggacaacaccttcgcgggc
cgtcgccgggaactgctcgacgagcgacgtcggcgcagggaacggctggcctccggagag
gagacgttgggtttcctgccgcagacccaacggatccgcaacgacgagacgtggcaggtg
gctccacccgcgcccggtcttgaggaccgcagggtggagatcaccggtccgcccgaccgc
aagatgacggtcaacgcgttgaactccggggcgaaggtgtggctcgccgatttcgaggac
gcgacgtcaccgacgtggcacaacatcgtgtcggggcagctcaacctgtacgacgcgatc
cggcgcaacatcgacttcaccgaccggggcaagcggtacgtgatcggcgacgagccggcc
acgatcgtcgccaggccgaggggctggcacctggtggagaagcacatccggatcgacggc
cgtcccgtgtcggccagtctcgtcgacttcggcctgtatttcttccacaacgcacgacag
ctgttggctcgcggtagcggcccgtacttctatctgccgaaactggagagccatctcgaa
gcgcggttgtggaacgacgtgttcctgctggcgcaggaagagctcggcatcccgaggggc
agtatccgcgcgaccgtgctgatcgagacgatcaccgcggcgttcgagatggacgagatc
ctgtacgagctgcgcgaacacgccgccgggttgaacgcgggccgatgggactacatcttc
agcatcatcaagaccttcgcctcccacggagcggacttcgtgctgccggaccgggcgcag
gtcacgatgacggtgccgttcatgcgggcctacaccgagttgctggtgcgcacgtgtcac
aagcgcggtgcacacgcgatcggtgggatggcggcgttcatcccgagtcgggacccggag
gtgaacgcgaccgcgttggagcgggtgcggcaggacaaggaacgcgaggccggcgacggt
ttcgacggttcgtgggtcgcccaccccggactcgtgccggtgtgtcgcgaggtgttcgac
gagttcttgggcgggtggccgaatcagctcggcagactgcgtgaggacgtcgccgtcacg
gcgcacgacctgctcgacgtggtgagcgcgggtggcgaggtcaccgagcagggcgtccga
tcgaacatcaacgtggctctgcgttacatcgatgcgtggctgcgcggtacgggcgccgcg
gcgatcttcaacctcatggaggacgccgccacggcggagatcgcccggtgtcaggtgtgg
cagtgggtccgcaacggcacgaaactggccgacggcaccgcggtcacgcgtgagcgggtg
acggagtggttggacatcgagctcgcggccgtgtacgccgatctcggtgcggacaaccgg
ctcagtgaggcccgggagatcttcgtcgagacggcgctgggtgagaagctgccgagtttc
ttcaccacgggtgcctatgcgcggtacttgacaacgccgagctga

DBGET integrated database retrieval system