KEGG   Saccharomonospora viridis: Svir_28460Help
Entry
Svir_28460        CDS       T00980                                 

Definition
(GenBank) short chain enoyl-CoA hydratase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
svi  Saccharomonospora viridis
Pathway
svi00071  Fatty acid degradation
svi00280  Valine, leucine and isoleucine degradation
svi00281  Geraniol degradation
svi00310  Lysine degradation
svi00360  Phenylalanine metabolism
svi00362  Benzoate degradation
svi00380  Tryptophan metabolism
svi00410  beta-Alanine metabolism
svi00627  Aminobenzoate degradation
svi00640  Propanoate metabolism
svi00650  Butanoate metabolism
svi00903  Limonene and pinene degradation
svi00930  Caprolactam degradation
svi01100  Metabolic pathways
svi01110  Biosynthesis of secondary metabolites
svi01120  Microbial metabolism in diverse environments
svi01130  Biosynthesis of antibiotics
svi01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:svi00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Svir_28460
   00650 Butanoate metabolism
    Svir_28460
  Lipid metabolism
   00071 Fatty acid degradation
    Svir_28460
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Svir_28460
   00310 Lysine degradation
    Svir_28460
   00360 Phenylalanine metabolism
    Svir_28460
   00380 Tryptophan metabolism
    Svir_28460
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Svir_28460
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Svir_28460
   00281 Geraniol degradation
    Svir_28460
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Svir_28460
   00627 Aminobenzoate degradation
    Svir_28460
   00930 Caprolactam degradation
    Svir_28460
Enzymes [BR:svi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Svir_28460
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2 AXE1 SDH_sah
Motif
Other DBs
NCBI-ProteinID: ACU97827
UniProt: C7MW58
Position
complement(3090276..3091055)
Genome map
AA seq 259 aa AA seqDB search
MGEFVRLEVDAGVGTIRLDRPPVNALNNQVQAELAEAAKEAAERDDVRAVILYGGEKTFA
GGADIKEMAAKSYVEMQRFGTALSESLTLIAELPKPTVAAITGYALGGGLELALTADRRV
AGDNVKVGQPEIQLGIIPGAGGTQRLARLVGPSRAKDIVFTGRFVKAEEALAIGLVDEVV
APDEVYAAAHRWASQFVNGPAVALRAAKIAIDAGLDMDLRNGLKLETQLFTGLWATEDQK
RGMQSFIENGPGKATFEGK
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
gtgggcgagttcgtgcgtctcgaggtcgacgcgggtgtcggcaccatccggctggaccgg
ccgccggtgaacgccctgaacaaccaggtgcaggcggaactggccgaggccgcgaaggaa
gcggcggagcgcgacgacgtgcgggccgtcatcctctacggcggggagaagaccttcgcg
ggcggcgccgacatcaaggagatggccgcgaagtcctatgtcgagatgcagcggttcggc
acggcgctgtcggagtcgttgaccctgatcgcggagctgccgaagcccacggtcgccgcg
atcaccggttacgcgctgggtggtgggctcgagctggcgttgaccgccgaccgcagggtg
gcgggcgacaacgtcaaggtgggacagccggagatccagctcggcatcatccccggagcg
ggcggtacccaacgactcgccaggttggtgggaccgagccgggccaaggacatcgtgttc
accggccggttcgtcaaggccgaggaggcgctggccatcggtctggtcgacgaggtcgtg
gcgcccgacgaggtgtacgccgccgcgcatcggtgggcctcgcagttcgtgaacggcccg
gccgtggcgctgcgggcggcgaagatcgccatcgacgccggtctcgacatggacctgcgc
aacgggttgaagctggagacccagctgttcaccggcctgtgggcgaccgaggaccagaag
cgcggtatgcagtcgttcatcgagaacgggccgggcaaggccaccttcgaggggaagtga

DBGET integrated database retrieval system