KEGG   Saccharomonospora viridis: Svir_28670Help
Entry
Svir_28670        CDS       T00980                                 

Gene name
tpiA
Definition
(RefSeq) triosephosphate isomerase
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
svi  Saccharomonospora viridis
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:svi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Svir_28670 (tpiA)
   01230 Biosynthesis of amino acids
    Svir_28670 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Svir_28670 (tpiA)
   00051 Fructose and mannose metabolism
    Svir_28670 (tpiA)
   00562 Inositol phosphate metabolism
    Svir_28670 (tpiA)
Enzymes [BR:svi01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Svir_28670 (tpiA)
Exosome [BR:svi04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Svir_28670 (tpiA)
  Exosomal proteins of bladder cancer cells
   Svir_28670 (tpiA)
  Exosomal proteins of melanoma cells
   Svir_28670 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3112647..3113399)
Genome map
AA seq 250 aa AA seqDB search
MGTSWKMNKTLAQARDYTVRLVKELGDRDLTGVQPFIIPPFTALATVREIAVDDPRVILG
AQNAHWDDAGAWTGEISVPQALDAGARIIEIGHSERRQHFGETIETTRLKVAAALRHGAL
ALLCVGEPAEVRDAGRSTAYILEQAEGALAGLSDEQLRSVLIAYEPIWAIGEAGRPATPE
ELRGPFAALRERFGDRVRGLLYGGSVNQDNAPDLLRIDGVDGLFVGRAAWEVEGFLALLD
IATAHNSTDS
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgggcaccagctggaagatgaacaagacgctggcgcaggcgcgtgactacaccgtccgg
ctcgtcaaggagttgggggatcgcgacctcaccggcgtacagccgttcatcattccaccg
ttcaccgcactcgccacggtacgcgagatcgcggtggacgatccccgcgtcatcctcggc
gcccagaacgcgcactgggatgacgcgggggcctggacgggcgagatctccgtaccccaa
gcgctcgacgccggcgcacgcatcatcgagatcggccactcggagcgtcggcagcacttc
ggggagaccatcgagacgacgaggctgaaagtcgcagccgcgctccggcacggggcactg
gctctcctctgcgtcggggaacccgccgaggtccgggacgccgggcggagcaccgcctac
atcctcgagcaggccgagggagcgctcgcgggtttgtccgacgagcaactccggtccgtg
ctcatcgcctacgagccgatctgggccatcggtgaggccgggcgccccgcgacaccggag
gagctgcgcggtcccttcgcggcactgcgtgaacgattcggcgaccgcgtgcggggcctg
ttgtacggcgggtcggtgaaccaggacaacgccccggacctgctccgtatcgacggtgtc
gacgggttgttcgtcgggcgggccgcatgggaggtcgagggcttcctggcgctgttggac
atcgccacggcccacaactccaccgactcttaa

DBGET integrated database retrieval system