KEGG   Saccharomonospora viridis: Svir_28670Help
Entry
Svir_28670        CDS       T00980                                 

Definition
(GenBank) triosephosphate isomerase
  KO
K20905  
L-erythrulose 4-phosphate epimerase [EC:5.1.3.39]
Organism
svi  Saccharomonospora viridis
Brite
Enzymes [BR:svi01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.39  L-erythrulose 4-phosphate epimerase
     Svir_28670
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(3112647..3113399)
Genome map
AA seq 250 aa AA seqDB search
MGTSWKMNKTLAQARDYTVRLVKELGDRDLTGVQPFIIPPFTALATVREIAVDDPRVILG
AQNAHWDDAGAWTGEISVPQALDAGARIIEIGHSERRQHFGETIETTRLKVAAALRHGAL
ALLCVGEPAEVRDAGRSTAYILEQAEGALAGLSDEQLRSVLIAYEPIWAIGEAGRPATPE
ELRGPFAALRERFGDRVRGLLYGGSVNQDNAPDLLRIDGVDGLFVGRAAWEVEGFLALLD
IATAHNSTDS
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgggcaccagctggaagatgaacaagacgctggcgcaggcgcgtgactacaccgtccgg
ctcgtcaaggagttgggggatcgcgacctcaccggcgtacagccgttcatcattccaccg
ttcaccgcactcgccacggtacgcgagatcgcggtggacgatccccgcgtcatcctcggc
gcccagaacgcgcactgggatgacgcgggggcctggacgggcgagatctccgtaccccaa
gcgctcgacgccggcgcacgcatcatcgagatcggccactcggagcgtcggcagcacttc
ggggagaccatcgagacgacgaggctgaaagtcgcagccgcgctccggcacggggcactg
gctctcctctgcgtcggggaacccgccgaggtccgggacgccgggcggagcaccgcctac
atcctcgagcaggccgagggagcgctcgcgggtttgtccgacgagcaactccggtccgtg
ctcatcgcctacgagccgatctgggccatcggtgaggccgggcgccccgcgacaccggag
gagctgcgcggtcccttcgcggcactgcgtgaacgattcggcgaccgcgtgcggggcctg
ttgtacggcgggtcggtgaaccaggacaacgccccggacctgctccgtatcgacggtgtc
gacgggttgttcgtcgggcgggccgcatgggaggtcgagggcttcctggcgctgttggac
atcgccacggcccacaactccaccgactcttaa

DBGET integrated database retrieval system