KEGG   Saccharomonospora viridis: Svir_28670Help
Entry
Svir_28670        CDS       T00980                                 

Definition
(GenBank) triosephosphate isomerase
  KO
K21910  
L-erythrulose 1-phosphate isomerase [EC:5.3.1.33]
Organism
svi  Saccharomonospora viridis
Brite
Enzymes [BR:svi01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.33  L-erythrulose 1-phosphate isomerase
     Svir_28670
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(3112647..3113399)
Genome map
AA seq 250 aa AA seqDB search
MGTSWKMNKTLAQARDYTVRLVKELGDRDLTGVQPFIIPPFTALATVREIAVDDPRVILG
AQNAHWDDAGAWTGEISVPQALDAGARIIEIGHSERRQHFGETIETTRLKVAAALRHGAL
ALLCVGEPAEVRDAGRSTAYILEQAEGALAGLSDEQLRSVLIAYEPIWAIGEAGRPATPE
ELRGPFAALRERFGDRVRGLLYGGSVNQDNAPDLLRIDGVDGLFVGRAAWEVEGFLALLD
IATAHNSTDS
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgggcaccagctggaagatgaacaagacgctggcgcaggcgcgtgactacaccgtccgg
ctcgtcaaggagttgggggatcgcgacctcaccggcgtacagccgttcatcattccaccg
ttcaccgcactcgccacggtacgcgagatcgcggtggacgatccccgcgtcatcctcggc
gcccagaacgcgcactgggatgacgcgggggcctggacgggcgagatctccgtaccccaa
gcgctcgacgccggcgcacgcatcatcgagatcggccactcggagcgtcggcagcacttc
ggggagaccatcgagacgacgaggctgaaagtcgcagccgcgctccggcacggggcactg
gctctcctctgcgtcggggaacccgccgaggtccgggacgccgggcggagcaccgcctac
atcctcgagcaggccgagggagcgctcgcgggtttgtccgacgagcaactccggtccgtg
ctcatcgcctacgagccgatctgggccatcggtgaggccgggcgccccgcgacaccggag
gagctgcgcggtcccttcgcggcactgcgtgaacgattcggcgaccgcgtgcggggcctg
ttgtacggcgggtcggtgaaccaggacaacgccccggacctgctccgtatcgacggtgtc
gacgggttgttcgtcgggcgggccgcatgggaggtcgagggcttcctggcgctgttggac
atcgccacggcccacaactccaccgactcttaa

DBGET integrated database retrieval system