KEGG   Saccharomonospora viridis: Svir_30650Help
Entry
Svir_30650        CDS       T00980                                 

Definition
choline dehydrogenase-like flavoprotein (EC:1.1.3.6)
Orthology
K03333  
cholesterol oxidase [EC:1.1.3.6]
Organism
svi  Saccharomonospora viridis
Pathway
Steroid degradation
Brite
KEGG Orthology (KO) [BR:svi00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00984 Steroid degradation
    Svir_30650
Enzymes [BR:svi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.3  With oxygen as acceptor
    1.1.3.6  cholesterol oxidase
     Svir_30650
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3326599..3328203)
Genome map
AA seq 534 aa AA seqDB search
MRPLSRRRLLGLLAVNTASALGLGTIATPSAAAASRRDFSPAVVVGTGYGAAVTALRLGQ
AGIPTVMLEMGRLWDTPGDDGRVFCDMLNPDRRAMWLATRTQMPLSSFLWLDIDRRIERF
TGVLDCVHHGDISVYVGRGVGGGSLVNGAMAVTPKRATFAEAFPDVDSDGMYRTYFPRAA
AMLGVNHIDPAWFETCESYRYARVSRAHAHNAGLTTTFVPSVYDFARMRREEAGEVPRSA
LAAEVIYGNNHGKRSLDKTYLADALGTGCVSIRTLHHVRAIEQDADGTYVLTVDELDLDG
TRVATRQLGARYLFLGAGSLGSTELLLRARDTGALPGLSPLIGRDWGPNGNVMVGRANRP
RDRTGTVQSGMPALGIDAWDDPRHPVFAEVAPMPAGVELWVSLYLAVTRNPERGLLTYDA
GSDRVRLHWLSGQAQPSVDQAKALFDRLNAANGTEYRSDLFGDTRVFETRLTYHPLGGAV
LGKATDAYGRVRGQRRLYVTDGSLVPGNIGVNPFLTITALAERNIERILAEDLR
NT seq 1605 nt NT seq  +upstreamnt  +downstreamnt
atgcgtccgctctcccgtaggcgtctgctcggcctgctcgcggtgaacacggcgagcgcc
ctcgggctgggcaccatcgccacgccatccgctgcggcagcgagtcgccgggacttctcg
cccgccgtggtggtcggtaccggctacggcgccgccgtgacggcgttgcggctcgggcag
gcgggcatccccaccgtgatgctggagatgggccgactctgggacacgccgggcgacgac
ggccgtgtcttctgcgacatgctcaaccccgaccgtcgcgccatgtggctggccacccgc
acgcagatgccgctgtcgtcgtttttgtggctcgacatcgaccgccgcatcgagcgcttc
accggcgtgctcgactgcgtccaccacggtgacatctcggtctacgtcggacgcggcgtc
ggaggtggttcgctcgtcaacggtgcgatggcggtcacgccgaagcgagcgacgttcgcc
gaggcgttccccgacgtcgacagcgacgggatgtaccgaacctatttcccccgtgccgcg
gcgatgctgggtgtcaaccacatcgatcccgcgtggttcgagacctgcgagtcgtaccgc
tacgcgcgtgtgtcccgagcccatgcgcacaacgcgggtctgaccacgacgttcgtgccc
agcgtctacgacttcgctcggatgcggcgtgaggaggcgggggaggtaccccggtcggcg
ctggccgccgaggtgatctacggcaacaaccacggcaagcgctcattggacaagacctat
ctcgccgacgcactcgggacgggatgtgtgtcgatccggacgctgcatcacgtgcgggcg
atcgaacaggatgcggacggcacgtacgtgctcaccgtcgacgagctcgatctcgacgga
acccgtgtggccacacggcaactcggggcgcgatacctgttcctcggcgcgggcagtctc
ggttcgaccgagttgttgctccgcgcccgggacaccggggccctgcccgggctcagcccc
ctgatcggccgggattgggggccgaacggcaacgtgatggtggggcgcgcgaaccgtccg
cgggaccggacgggcaccgtgcagtcgggaatgcccgcgctcggcatcgacgcctgggac
gatccccgacatccggtgttcgccgaggtcgcccccatgccggcgggtgtggagctgtgg
gtgagcctgtacctggccgtcacgaggaatcccgaacgaggcctcctcacgtacgacgcc
ggctccgaccgggtgcgcctgcactggctaagcgggcaggcacagccgtccgtcgaccag
gcgaaagcgttgttcgaccgcctcaacgccgcgaacggcaccgaataccggtcggatctg
ttcggcgacacccgcgtgttcgaaacccgactcacctatcacccgctcggcggggccgtg
ctcggcaaggcgaccgacgcctacggccgggtgcggggacagcgccgtctctacgtcacc
gacggctccctggtgcccggcaacatcggcgtcaacccattcctcaccatcaccgcgttg
gccgagcgcaacatcgagcggatcctcgccgaggacctgcgttga

DBGET integrated database retrieval system