KEGG   Saccharomonospora viridis: Svir_32120Help
Entry
Svir_32120        CDS       T00980                                 

Definition
ribulose-5-phosphate 4-epimerase-like epimerase or aldolase
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
svi  Saccharomonospora viridis
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:svi00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    Svir_32120
Enzymes [BR:svi01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     Svir_32120
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3481212..3481862
Genome map
AA seq 216 aa AA seqDB search
MLLAEHREAVCAYARRMVADGLVVGTSGNISVREGDLVAVTPTGVDYESLRPEDIPVLRL
DGTPVEGDLKPTSEMPMHLAIYRDAKDPDGADINAVVHTHSTHAVAVSTVVDEVPPVHYM
VAAIGPSVRVAPYATYGTQELADVMLTALDGRRGCLLGNHGTVTYGTDLAAAYSRAQQLE
WVCQVWLMARSVGSPRLLPRAEIGHVVERLRGYGQK
NT seq 651 nt NT seq  +upstreamnt  +downstreamnt
atgctgcttgccgaacaccgcgaagccgtgtgcgcctatgcccgcaggatggtcgccgac
gggctcgtcgtcggcacgtccgggaacatctcggtgcgggagggcgatctcgtggccgtc
acgccgaccggcgtggactacgagtcgttgcgtccggaggacatccccgtactgcggctc
gacggcaccccggtggagggcgacctgaagccgaccagcgagatgccgatgcacctggcg
atctaccgcgacgccaaggacccggacggggccgacatcaacgcggtggtgcacacccac
tccacccacgccgtcgctgtgtccactgtggtcgacgaggtgccgccggtgcactacatg
gtcgcggccatcggcccgagcgtgcgtgtcgcaccgtacgccacgtacggcacgcaggag
ctcgccgacgtcatgctcaccgcgttggacgggcgacgcggctgtctgctcggcaaccac
ggcaccgtcacctacggcaccgatctcgcagcggcgtactcccgcgcgcagcagctggag
tgggtgtgccaggtgtggttgatggcgcgttcggtcggttccccccgactcctgccgcgc
gccgagatcgggcacgtggtcgaacggctgcgcggctacggccagaagtag

DBGET integrated database retrieval system